PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PH01004399G0090 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 154aa MW: 17084.7 Da PI: 10.8064 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 30.4 | 8.6e-10 | 34 | 69 | 13 | 48 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 13 NReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 NR +A+rsR RK++++ eLe+ v +L+ e +aL + PH01004399G0090 34 NRQSAQRSRVRKLQYTSELERSVTTLQMEVSALSPR 69 ***************************999988765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 3.5E-6 | 25 | 86 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 7.74E-10 | 28 | 80 | No hit | No description |
CDD | cd14703 | 3.62E-14 | 31 | 77 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 3.7E-12 | 32 | 80 | No hit | No description |
Pfam | PF00170 | 8.5E-8 | 33 | 75 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MARAAMERML LGFQAAAPRP LLWAARAEAE VLANRQSAQR SRVRKLQYTS ELERSVTTLQ 60 MEVSALSPRV AFLDHQRSLL TVGNSHLKQR IAALAQDRIF KDAHQEALKQ EIERLRQLYH 120 HQQIKATGGA DIAAAASMQA KQELLACEGA AMR* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription regulator. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PH01004399G0090 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By white light. {ECO:0000269|PubMed:18065552}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP096247 | 1e-171 | FP096247.1 Phyllostachys edulis cDNA clone: bphyst038a13, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015622790.1 | 7e-76 | basic leucine zipper 19 | ||||
Swissprot | Q6K3R9 | 6e-77 | BZP19_ORYSJ; Basic leucine zipper 19 | ||||
TrEMBL | A0A0D9VE89 | 4e-75 | A0A0D9VE89_9ORYZ; Uncharacterized protein | ||||
STRING | LPERR02G08830.1 | 7e-76 | (Leersia perrieri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1322 | 38 | 125 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G58120.1 | 2e-50 | bZIP family protein |