PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002104G0150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 279aa    MW: 30138.6 Da    PI: 10.3632
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002104G0150genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding537.9e-171964147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+++G+ +W+++a+++  gR++k+c++rw++ 
  PH01002104G0150 19 RGHWRPGEDEKLRQLVEKYGPQNWNSVAEKLE-GRSGKSCRLRWFNQ 64
                     899*****************************.***********996 PP

2Myb_DNA-binding55.71.2e-1772115247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++T+eE+e+l+ a + +G++ W++Iar+++ gRt++ +k++w+ +
  PH01002104G0150  72 RPFTKEEEERLLAANRVHGNK-WALIARHFP-GRTDNAVKNHWHVV 115
                      69*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.0241465IPR017930Myb domain
SuperFamilySSF466893.74E-2917112IPR009057Homeodomain-like
SMARTSM007177.2E-141867IPR001005SANT/Myb domain
PfamPF002491.8E-161964IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-262072IPR009057Homeodomain-like
CDDcd001677.52E-142263No hitNo description
PROSITE profilePS5129426.42866120IPR017930Myb domain
SMARTSM007174.3E-1570118IPR001005SANT/Myb domain
PfamPF002491.9E-1471114IPR001005SANT/Myb domain
CDDcd001676.04E-1373113No hitNo description
Gene3DG3DSA:1.10.10.603.1E-2073115IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MASSSTTNTS DGAKSSCPRG HWRPGEDEKL RQLVEKYGPQ NWNSVAEKLE GRSGKSCRLR  60
WFNQLDPRIN KRPFTKEEEE RLLAANRVHG NKWALIARHF PGRTDNAVKN HWHVVRARRS  120
RERSRLLAKA ASSLPTYAGA GGQLEFGSVP ATSAGSLCFG FSMLSSGGGL FSSSAAAAPP  180
QLFKSYGNAT PSSKMSLVGT SFEAANYSYG GKQSTMAPAL SITFSSSSRE ALALDGLGHG  240
LRGGHDHHRT DNYHDGDEPL KRKQDVPFID FLGVGVSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28191197107B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01002104G0150
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0928530.0FP092853.1 Phyllostachys edulis cDNA clone: bphyem102e11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004979129.11e-112transcription factor CSA
TrEMBLA0A1E5UNM71e-113A0A1E5UNM7_9POAL; Transcription factor MYB44
STRINGSi026751m1e-112(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.14e-60myb domain protein 52