PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001064G0370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 393aa    MW: 43742.6 Da    PI: 5.9254
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001064G0370genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.12e-13149196148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT++Ed  lv  v+++G ++W+  a+  g++Rt+k+c++rw +yl
  PH01001064G0370 149 KGPWTEQEDVHLVWFVRLFGERRWDFLAKVSGLKRTGKSCRLRWVNYL 196
                      79********************************************97 PP

2Myb_DNA-binding55.21.7e-17202247148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr T++E+ l++++++q+G++ W++Iar+++ gRt++++k++w++++
  PH01001064G0370 202 RGRITPDEERLILQLHAQWGSR-WSRIARKLP-GRTDNEIKNYWRTHM 247
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF077274.5E-561101IPR013103Reverse transcriptase, RNA-dependent DNA polymerase
PROSITE profilePS5129412.94144196IPR017930Myb domain
SuperFamilySSF466896.79E-28146243IPR009057Homeodomain-like
SMARTSM007179.0E-11148198IPR001005SANT/Myb domain
PfamPF002495.3E-12149196IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-19150203IPR009057Homeodomain-like
CDDcd001672.64E-7151196No hitNo description
PROSITE profilePS5129425.826197251IPR017930Myb domain
SMARTSM007171.8E-16201249IPR001005SANT/Myb domain
PfamPF002494.2E-15202246IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-24204250IPR009057Homeodomain-like
CDDcd001677.25E-11206247No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MSFLCYRIQT LLRETSSPEP VIEYGPNESR AISPNATDVF HASESVAAEI IEDARGGNAD  60
DDIIIARSCD KASDKLIQQL LADFAIKDLG KLSYFLGVEA TYVAMLTKAK TAAKGGGRGR  120
RGGGVEEEEE ETMSIWNNNN TGGGGGMRKG PWTEQEDVHL VWFVRLFGER RWDFLAKVSG  180
LKRTGKSCRL RWVNYLHPGL KRGRITPDEE RLILQLHAQW GSRWSRIARK LPGRTDNEIK  240
NYWRTHMRKK AQDEKKKRAA ALASASPSSS SSSTSCSASL NNGTSSTWSA VTEALVQESS  300
SGDEAEETTT AASQHQQPPQ DQQEHYYRMD QLWNEIAAAE AATCYAEGWG TRHVVSSEPP  360
ASMPSPVWEF CADYSLWRID DEEYYNKMLD AS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-261492514105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115123GGRGRRGGG
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001064G0370
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519041e-119JF951904.1 Triticum aestivum clone TaMYB20 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020156198.11e-93myb-related protein MYBAS2-like
SwissprotQ4JL769e-68MYBA2_ORYSJ; Myb-related protein MYBAS2
TrEMBLA0A0E0PGP01e-98A0A0E0PGP0_ORYRU; Uncharacterized protein
STRINGORUFI05G01110.12e-99(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.33e-65myb domain protein 59
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]