PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PH01000961G0570 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 206aa MW: 22597.2 Da PI: 6.4102 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 106.8 | 2.7e-33 | 7 | 124 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 lppGf+F P+deelvv++L++k++ +++ ++i+++ + +++Pw+L+ k+ + ++wyfFs++ + +r+ +gyW++ g +++v+s PH01000961G0570 7 LPPGFHFFPSDEELVVHFLRRKASLLPCHP-DIIPTLLLRRYDPWELNGKALEAGNQWYFFSHATQ--------SRTSPNGYWNTIGAEETVTS 91 79*************************999.89**************966667789******9754........678889*************9 PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128 +g +vglkktL+f +g+ +g kt+W+mhey+l PH01000961G0570 92 -GGCNVGLKKTLIFSTGKPLQGIKTNWIMHEYHL 124 .99*****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.36E-44 | 4 | 168 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 40.95 | 7 | 169 | IPR003441 | NAC domain |
Pfam | PF02365 | 7.3E-22 | 8 | 124 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0043067 | Biological Process | regulation of programmed cell death | ||||
GO:0048367 | Biological Process | shoot system development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 206 aa Download sequence Send to blast |
MGGATNLPPG FHFFPSDEEL VVHFLRRKAS LLPCHPDIIP TLLLRRYDPW ELNGKALEAG 60 NQWYFFSHAT QSRTSPNGYW NTIGAEETVT SGGCNVGLKK TLIFSTGKPL QGIKTNWIMH 120 EYHLLDGGCS ASGISASSAS PSSNRKSHKK RGHSSTESNS WVICRVFESS CGSQVSFHDE 180 GTELSCLDEV FLSLDDYDEV SLPNN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-35 | 6 | 174 | 16 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-35 | 6 | 174 | 16 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-35 | 6 | 174 | 16 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-35 | 6 | 174 | 16 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-35 | 6 | 174 | 19 | 173 | NAC domain-containing protein 19 |
3swm_B | 1e-35 | 6 | 174 | 19 | 173 | NAC domain-containing protein 19 |
3swm_C | 1e-35 | 6 | 174 | 19 | 173 | NAC domain-containing protein 19 |
3swm_D | 1e-35 | 6 | 174 | 19 | 173 | NAC domain-containing protein 19 |
3swp_A | 1e-35 | 6 | 174 | 19 | 173 | NAC domain-containing protein 19 |
3swp_B | 1e-35 | 6 | 174 | 19 | 173 | NAC domain-containing protein 19 |
3swp_C | 1e-35 | 6 | 174 | 19 | 173 | NAC domain-containing protein 19 |
3swp_D | 1e-35 | 6 | 174 | 19 | 173 | NAC domain-containing protein 19 |
4dul_A | 1e-35 | 6 | 174 | 16 | 170 | NAC domain-containing protein 19 |
4dul_B | 1e-35 | 6 | 174 | 16 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PH01000961G0570 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021314570.1 | 1e-117 | NAC domain-containing protein 104 isoform X2 | ||||
Swissprot | Q8GWK6 | 6e-65 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A0A9FYS5 | 1e-120 | A0A0A9FYS5_ARUDO; Uncharacterized protein | ||||
STRING | LPERR02G16450.1 | 1e-121 | (Leersia perrieri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3667 | 36 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 8e-66 | xylem NAC domain 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|