PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PH01000887G0360

Organism

Phyllostachys heterocycla

Taxonomic ID

38705

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys

Family

bZIP

Protein Properties

Length: 278aa MW: 30363.8 Da PI: 6.3785

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PH01000887G0360	genome	ICBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	49.1	1.3e-15	135	177	5	47
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 +r+rr++kNRe+A rsR+RK+a+i eLe +v++L+++N++L+k PH01000887G0360 135 RRQRRMIKNRESAARSRARKQAYITELEAEVAKLKEQNEELQK 177 79*************************************9987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	2.8E-17	131	198	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	11.679	133	199	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	3.0E-15	135	177	No hit	No description
Pfam	PF00170	2.3E-13	135	178	IPR004827	Basic-leucine zipper domain
CDD	cd14707	4.40E-25	135	179	No hit	No description
SuperFamily	SSF57959	5.47E-11	135	178	No hit	No description
PROSITE pattern	PS00036	0	138	153	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	1.0E-4	178	210	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 278 aa Download sequence Send to blast
MDFGGGDEAP AAPPEQAQRQ PTLGEMTLEE FLVRAGVVRE DMGQLIVLPE QAQALFPQGN 60 VVAPAMQLGN GMVPGVVGQG AGGGMTVAAP ATPAVLNGLG KVEGGDLSSL SPVPYRFDSA 120 LRVRKGPTVE KVVERRQRRM IKNRESAARS RARKQAYITE LEAEVAKLKE QNEELQKKQA 180 YITELEAEVA KLKEQNEELQ KKQVEMLKKQ KDENSPIVHP TTIINTDVGH IVHVTDTLAP 240 YPFSFFVIKL ATWGHGFVQT LNMVMPFIHD ICTNKSE*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in abscisic acid (ABA) signaling pathway (PubMed:20576316, PubMed:19947981, PubMed:21546455, PubMed:22301130, PubMed:26300907, PubMed:27468891). Transcription factor activity is fully activated by ABA (PubMed:19947981, PubMed:26300907, PubMed:27468891). Acts as positive regulator of the expression of abiotic stress-responsive genes through an ABA-dependent signaling pathway (PubMed:20576316). Acts as positive regulator of ABA signaling and drought stress tolerance (PubMed:22301130). Plays an important role in ABA and auxin responses. Involved in ABA signaling and stress responses by directly binding to the ABA-responsive element (ABRE)-containing genes, especially WRKY family genes. Modulates response to auxin. Suppresses auxin signaling by targeting ABRE-containing genes related to auxin metabolism or signaling (PubMed:21546455). {ECO:0000269\|PubMed:19947981, ECO:0000269\|PubMed:20576316, ECO:0000269\|PubMed:21546455, ECO:0000269\|PubMed:22301130, ECO:0000269\|PubMed:26300907, ECO:0000269\|PubMed:27468891}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PH01000887G0360

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) (PubMed:20576316, PubMed:18315698, PubMed:21546455, PubMed:22301130). Induced by auxin (PubMed:21546455, PubMed:22301130). Induced by gibberellin (PubMed:21546455). Induced by salt and drought stresses (PubMed:20576316, PubMed:21546455, PubMed:22301130). Induced by cold stress (PubMed:20576316). Induced by oxidative stress (PubMed:20576316, PubMed:22301130). {ECO:0000269\|PubMed:18315698, ECO:0000269\|PubMed:20576316, ECO:0000269\|PubMed:21546455, ECO:0000269\|PubMed:22301130}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK363330	1e-135	AK363330.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2014H23.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004964902.1	7e-90	bZIP transcription factor 46
Swissprot	Q69TW5	5e-81	BZP46_ORYSJ; bZIP transcription factor 46
TrEMBL	A0A3L6S319	3e-90	A0A3L6S319_PANMI; ABSCISIC ACID-INSENSITIVE 5-like protein 5
STRING	Si006889m	3e-89	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP706	38	147

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G45249.1	3e-28	abscisic acid responsive elements-binding factor 2

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Hossain MA, et al. The ABRE-binding bZIP transcription factor OsABF2 is a positive regulator of abiotic stress and ABA signaling in rice. J. Plant Physiol., 2010. 167(17): p. 1512-20 [PMID:20576316] Yang X, et al. Rice ABI5-Like1 regulates abscisic acid and auxin responses by affecting the expression of ABRE-containing genes. Plant Physiol., 2011. 156(3): p. 1397-409 [PMID:21546455] Li YS, et al. A novel nuclear protein phosphatase 2C negatively regulated by ABL1 is involved in abiotic stress and panicle development in rice. Mol. Biotechnol., 2013. 54(2): p. 703-10 [PMID:23086454] Guo C,Ge X,Ma H The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages. Plant Mol. Biol., 2013. 82(3): p. 239-53 [PMID:23686450] Huang X, et al. OsSLI1, a homeodomain containing transcription activator, involves abscisic acid related stress response in rice (Oryza sativa L.). ScientificWorldJournal, 2014. 2014: p. 809353 [PMID:25089296] Kim N, et al. Functional characterization and reconstitution of ABA signaling components using transient gene expression in rice protoplasts. Front Plant Sci, 2015. 6: p. 614 [PMID:26300907] Chen H, et al. Characterization of OsPM19L1 encoding an AWPM-19-like family protein that is dramatically induced by osmotic stress in rice. Genet. Mol. Res., 2015. 14(4): p. 11994-2005 [PMID:26505346] Tang N, et al. MODD Mediates Deactivation and Degradation of OsbZIP46 to Negatively Regulate ABA Signaling and Drought Resistance in Rice. Plant Cell, 2016. 28(9): p. 2161-2177 [PMID:27468891]