PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PH01000823G0440 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 146aa MW: 16015 Da PI: 9.0785 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 44.8 | 2.7e-14 | 23 | 81 | 4 | 62 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 ++ +r+ +NRe+ArrsR+RK++++eeL +++ L+aeN + ++++ + e k++ e PH01000823G0440 23 ERKRKRMLSNRESARRSRARKQQRLEELIAEAARLQAENARVESQIDAYARELGKVDGE 81 46789999****************************************99988877766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 6.8E-18 | 20 | 84 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.794 | 22 | 85 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.4E-11 | 22 | 78 | No hit | No description |
Pfam | PF00170 | 3.1E-10 | 24 | 76 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.19E-10 | 24 | 76 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 27 | 42 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MSSHRSSSPE SGNTDGSGYA ADERKRKRML SNRESARRSR ARKQQRLEEL IAEAARLQAE 60 NARVESQIDA YARELGKVDG ENAVLRARHG ELAGRLQALG GVLEIFQVVG APVDIPEIPD 120 PMLRPWQPPF APQPIAAAAI ADAFQF |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 36 | 43 | RRSRARKQ |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PH01000823G0440 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP091611 | 0.0 | FP091611.1 Phyllostachys edulis cDNA clone: bphyst014n11, full insert sequence. | |||
GenBank | FP096429 | 0.0 | FP096429.1 Phyllostachys edulis cDNA clone: bphyst004a03, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006654003.1 | 3e-71 | PREDICTED: ocs element-binding factor 1-like | ||||
TrEMBL | A0A0E0KY13 | 2e-70 | A0A0E0KY13_ORYPU; Uncharacterized protein | ||||
STRING | OPUNC05G01750.1 | 3e-71 | (Oryza punctata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1886 | 35 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G62420.1 | 2e-25 | basic region/leucine zipper motif 53 |