PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000729G0470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 219aa    MW: 23255 Da    PI: 8.2172
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000729G0470genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.9e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv +++++G+g+W+++++  g+ R+ k+c++rw +yl
  PH01000729G0470 14 KGPWTPEEDLILVSYIQEHGSGNWRAVPSNTGLMRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.91.8e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T +E++l+v++ ++lG++ W++Ia++++  Rt++++k++w+++
  PH01000729G0470  67 RGNFTDQEEKLIVHLQALLGNR-WAAIASYLP-DRTDNDIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.879961IPR017930Myb domain
SuperFamilySSF466892.88E-3011108IPR009057Homeodomain-like
SMARTSM007171.1E-131363IPR001005SANT/Myb domain
PfamPF002497.9E-171461IPR001005SANT/Myb domain
CDDcd001671.83E-121661No hitNo description
PROSITE profilePS5129424.60362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2465117IPR009057Homeodomain-like
SMARTSM007175.0E-1666114IPR001005SANT/Myb domain
PfamPF002493.2E-1567111IPR001005SANT/Myb domain
CDDcd001672.16E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MGRPPCCDKA GVKKGPWTPE EDLILVSYIQ EHGSGNWRAV PSNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKLIVH LQALLGNRWA AIASYLPDRT DNDIKNYWNT HIKKKLKNMS  120
AGEDGAGEGW MRPGDGGGKA SSRSRSSASL SGEGASASHS GTAPTSEGST GTCKTKAGGA  180
AATAPAFSIL ESWLLDDGTG HGEVGLMDVP LGDPSEFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26141167108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000729G0470
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8377781e-147CT837778.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA023K22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015695616.11e-101PREDICTED: myb-related protein 306-like
SwissprotP813922e-80MYB06_ANTMA; Myb-related protein 306
TrEMBLM0T5W93e-87M0T5W9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P10700_0015e-88(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.21e-78myb domain protein 96
Publications ? help Back to Top
  1. Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C
    Expression patterns of myb genes from Antirrhinum flowers.
    Plant Cell, 1991. 3(2): p. 115-25
    [PMID:1840903]