PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000595G0350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 428aa    MW: 47009.6 Da    PI: 6.6933
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000595G0350genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.43e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  PH01000595G0350 14 KGLWSPEEDEKLMNHIAKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding47.15.6e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++eE++l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  PH01000595G0350  67 RGAFSQEEEDLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-27664IPR009057Homeodomain-like
PROSITE profilePS5129419.054961IPR017930Myb domain
SuperFamilySSF466897.86E-3012108IPR009057Homeodomain-like
SMARTSM007171.0E-121363IPR001005SANT/Myb domain
PfamPF002497.6E-161461IPR001005SANT/Myb domain
CDDcd001677.13E-121761No hitNo description
PROSITE profilePS5129425.61562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2565116IPR009057Homeodomain-like
SMARTSM007175.8E-1366114IPR001005SANT/Myb domain
PfamPF002499.2E-1467110IPR001005SANT/Myb domain
CDDcd001676.67E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLMNHIA KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQEEEDLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CIKKKLRQKG  120
IDPNTHKPLA EVDRSGAAPT ISTERTSGSS DVNPSSAGAL GNFSHLLSET AQSSMLLPVY  180
DKNRPETPSL ARPKVPPKEL FLDQIAAGHE SPSSCRSSGP TLYFPFQQPL GYSSECGSGD  240
GAHMNPLWFN QNDFNCSTIS TVMPPVSPSA LSTSMGLNLP PDNPRHGGTG IGSAPFYWDG  300
ANPSSSSSTG SSGSNGMGFE QQSTNSILEN SVFPWTDIGQ EKDTRVHLVE ELKWPDLLHG  360
TFAEATTAMQ NQSQSLYDDV IKAESQFNME GVCASWFQNQ QPQQQLQAAS GMYDKDLQRM  420
PLSFEHI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000595G0350
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4957840.0AJ495784.1 Oryza sativa Japonica Group mRNA for MYB16 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025881490.10.0transcription factor MYB61
TrEMBLA0A3S7M8N60.0A0A3S7M8N6_9POAL; MYB3 transcription factor
STRINGORUFI05G02790.20.0(Oryza rufipogon)
STRINGOS05T0140100-010.0(Oryza sativa)
STRINGONIVA05G02580.10.0(Oryza nivara)
STRINGOPUNC05G02540.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.17e-90myb domain protein 61