PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000569G0800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 265aa    MW: 28564 Da    PI: 5.6014
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000569G0800genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72.1e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++lv     +G  +W+++++  g+ R++k+c++rw +yl
  PH01000569G0800 14 RGPWTAEEDQKLVSFLLSHGHCCWRLVPKLAGLLRCGKSCRLRWTNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding55.71.1e-1770111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +++E++l +d+++qlG++ W++Ia++++ gRt++++k++w+++
  PH01000569G0800  70 LSEDEEKLVIDLHAQLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                      589****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-21563IPR009057Homeodomain-like
PROSITE profilePS5129415.163961IPR017930Myb domain
SuperFamilySSF466892.58E-2711108IPR009057Homeodomain-like
SMARTSM007171.5E-121363IPR001005SANT/Myb domain
PfamPF002499.2E-151461IPR001005SANT/Myb domain
CDDcd001671.38E-91661No hitNo description
PROSITE profilePS5129427.21562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2464117IPR009057Homeodomain-like
SMARTSM007171.1E-1566114IPR001005SANT/Myb domain
PfamPF002491.2E-1570111IPR001005SANT/Myb domain
CDDcd001672.19E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MGRQPCCEKV GLKRGPWTAE EDQKLVSFLL SHGHCCWRLV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEDEEKLVID LHAQLGNRWS KIAARLPGRT DNEIKNHWNT HIKKQLKKMG  120
IDPITHQPLA PVQSDPLKRQ QAQEHCDEPK PTSQEPAGSG SGNGADDEEE APVSAETKGA  180
TCSASSASTS AVSPSRSSSS ASASVATPGA DVDWPDPIDL FEVDGIMDID WAGFLSGSGG  240
DGGGISVDLL DHYSGVGFDQ EVWL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-30121165108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as positive regulator of abscisic acid (ABA) signaling in response to salt stress. Acts as negative regulator ABI1, ABI2 and PP2CA, which are protein phosphatases 2C acting as negative regulator of ABA signaling. Binds to the DNA specific sequence and core element 5'-ACGT-3' found in the promoters of ABI1 and PP2CA to negatively regulate their expression during ABA-dependent salt stress response. {ECO:0000269|PubMed:23660402}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000569G0800
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress, drought stress and abscisic acid (ABA). Down-regulated by salicylic acid (SA) methyl jasmonate (JA). {ECO:0000269|PubMed:23660402}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1087091e-135AK108709.1 Oryza sativa Japonica Group cDNA clone:002-150-A10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953828.11e-126protein ODORANT1
SwissprotQ9C7U71e-82MYB20_ARATH; Transcription factor MYB20
TrEMBLK3Z1081e-125K3Z108_SETIT; Uncharacterized protein
STRINGSi020225m1e-125(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.11e-83myb domain protein 20
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]