PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT1G66230.1 | ||||||||
Common Name | AtMYB20, MYB20, T6J19.5 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 282aa MW: 32336.4 Da PI: 4.8999 | ||||||||
Description | myb domain protein 20 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47.2 | 5.2e-15 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +l++ + G +W+++++ g+ R++k+c++rw +yl AT1G66230.1 14 KGPWTAEEDRKLINFILTNGQCCWRAVPKLSGLLRCGKSCRLRWTNYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 50.1 | 6.2e-16 | 73 | 111 | 7 | 47 |
HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 E++ +d++ qlG++ W++Ia++++ gRt++++k++w+++ AT1G66230.1 73 YEEKMVIDLHSQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111 599*************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.4E-20 | 5 | 62 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 14.186 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.87E-26 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.0E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.9E-13 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.76E-8 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 25.041 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.4E-24 | 63 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.6E-13 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-13 | 73 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.98E-10 | 74 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:2000652 | Biological Process | regulation of secondary cell wall biogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0005352 | anatomy | xylem | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 282 aa Download sequence Send to blast |
MGRQPCCDKV GLKKGPWTAE EDRKLINFIL TNGQCCWRAV PKLSGLLRCG KSCRLRWTNY 60 LRPDLKRGLL SDYEEKMVID LHSQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLRKMG 120 IDPLTHKPLS IVEKEDEEPL KKLQNNTVPF QETMERPLEN NIKNISRLEE SLGDDQFMEI 180 NLEYGVEDVP LIETESLDLI CSNSTMSSST STSSHSSNDS SFLKDLQFPE FEWSDYGNSN 240 NDNNNGVDNI IENNMMSLWE ISDFSSLDLL LNDESSSTFG LF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-28 | 12 | 116 | 5 | 108 | B-MYB |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.10901 | 0.0 | cell culture| leaf |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 30697318 | 0.0 | ||||
Genevisible | 259822_at | 0.0 | ||||
Expression Atlas | AT1G66230 | - | ||||
AtGenExpress | AT1G66230 | - | ||||
ATTED-II | AT1G66230 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in chalaza of mature seeds, cotyledons, rosette leaves, cauline leaves, veins of stems, mature siliques, sepals and styles. Expressed at low levels in roots. {ECO:0000269|PubMed:23660402}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes a putative transcription factor (MYB20). | |||||
UniProt | Transcription factor that acts as positive regulator of abscisic acid (ABA) signaling in response to salt stress. Acts as negative regulator ABI1, ABI2 and PP2CA, which are protein phosphatases 2C acting as negative regulator of ABA signaling. Binds to the DNA specific sequence and core element 5'-ACGT-3' found in the promoters of ABI1 and PP2CA to negatively regulate their expression during ABA-dependent salt stress response. {ECO:0000269|PubMed:23660402}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT1G66230.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress, drought stress and abscisic acid (ABA). Down-regulated by salicylic acid (SA) methyl jasmonate (JA). {ECO:0000269|PubMed:23660402}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator (A: Activate/R: Repress) | |||||
ATRM | AT1G32770 (A) |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT1G66230 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519565 | 0.0 | AY519565.1 Arabidopsis thaliana MYB transcription factor (At1g66230) mRNA, complete cds. | |||
GenBank | BT028904 | 0.0 | BT028904.1 Arabidopsis thaliana unknown protein (At1g66230) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_176797.1 | 0.0 | myb domain protein 20 | ||||
Swissprot | Q9C7U7 | 0.0 | MYB20_ARATH; Transcription factor MYB20 | ||||
TrEMBL | A0A178WEN2 | 0.0 | A0A178WEN2_ARATH; MYB20 | ||||
STRING | AT1G66230.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 | Representative plant | OGRP5 | 17 | 1784 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT1G66230.1 |
Entrez Gene | 842938 |
iHOP | AT1G66230 |
wikigenes | AT1G66230 |