PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000415G0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 293aa    MW: 31593.9 Da    PI: 7.919
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000415G0010genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+llvd+++  G g+W++ ++  g++R++k+c++rw +yl
  PH01000415G0010 14 KGPWTPEEDKLLVDYIQANGHGSWRLLPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding507.1e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ +v+++   G++ W+ Ia+ ++ gRt++++k++w+++l
  PH01000415G0010  67 RGPFTPEEQKSIVQLHGIVGNK-WSMIAAQLP-GRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-24563IPR009057Homeodomain-like
PROSITE profilePS5129418.259961IPR017930Myb domain
SuperFamilySSF466891.68E-3111108IPR009057Homeodomain-like
SMARTSM007173.7E-141363IPR001005SANT/Myb domain
PfamPF002491.9E-161461IPR001005SANT/Myb domain
CDDcd001672.86E-101661No hitNo description
PROSITE profilePS5129425.91262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2664116IPR009057Homeodomain-like
SMARTSM007171.8E-1466114IPR001005SANT/Myb domain
PfamPF002496.4E-1467112IPR001005SANT/Myb domain
CDDcd001672.80E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MGRAPCCDKK GLKKGPWTPE EDKLLVDYIQ ANGHGSWRLL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGPF TPEEQKSIVQ LHGIVGNKWS MIAAQLPGRT DNEIKNYWNT HLKKQLRRMG  120
LDEPPPGPAA GCPAARHMAQ WETARLEAEA RLSLLSSSGT AATASASSSS TAVPVAAAAA  180
EHATPVDFFL RLWNSDIGNS FRKVAAAAGS SLPMAVKKDA VKQEAVLPGD DSSAASNEME  240
AADQAVDEYQ MFLDFAGEEL GLFHGRHGGF SLFPPIDVLA EASLDTAFLR PS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28121165108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may play a role in flower development by repressing ANT (PubMed:19232308). Regulates the transition of meristem identity from vegetative growth to flowering. Acts downstream of LFY and upstream of AP1. Directly activates AP1 to promote floral fate. Together with LFY and AP1 may constitute a regulatory network that contributes to an abrupt and robust meristem identity transition (PubMed:21750030). {ECO:0000269|PubMed:19232308, ECO:0000269|PubMed:21750030}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000415G0010
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1086210.0AK108621.1 Oryza sativa Japonica Group cDNA clone:002-147-D04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020168349.11e-163transcription factor MYB6
SwissprotQ9M2D94e-92MYB17_ARATH; Transcription factor MYB17
TrEMBLA0A3B6PPJ11e-163A0A3B6PPJ1_WHEAT; Uncharacterized protein
TrEMBLA0A446WFJ51e-163A0A446WFJ5_TRITD; Uncharacterized protein
STRINGEMT277661e-163(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54093157
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.17e-82myb domain protein 17