PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000374G0780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 510aa    MW: 56256.1 Da    PI: 8.122
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000374G0780genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding605.2e-192470148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++++d+vk++G   W+ Iar +  gR +kqc++rw+++l
  PH01000374G0780 24 KGPWTQEEDDKIIDLVKKYGATKWSVIARSLS-GRIGKQCRERWHNHL 70
                     79******************************.*************97 PP

2Myb_DNA-binding58.31.8e-1876119146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT+eE+  l++a++ +G++ W+ Ia+ ++ gRt++++k++w++
  PH01000374G0780  76 KDAWTAEEERALINAHQIYGNK-WAEIAKVLP-GRTDNSIKNHWNS 119
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.0E-8328IPR009057Homeodomain-like
PROSITE profilePS5129430.4321974IPR017930Myb domain
SuperFamilySSF466892.09E-3221117IPR009057Homeodomain-like
SMARTSM007172.3E-172372IPR001005SANT/Myb domain
PfamPF002494.3E-172470IPR001005SANT/Myb domain
CDDcd001671.09E-152670No hitNo description
Gene3DG3DSA:1.10.10.603.2E-262977IPR009057Homeodomain-like
PROSITE profilePS5129423.49475125IPR017930Myb domain
SMARTSM007173.4E-1875123IPR001005SANT/Myb domain
PfamPF002491.3E-1676119IPR001005SANT/Myb domain
CDDcd001677.42E-1578121No hitNo description
Gene3DG3DSA:1.10.10.604.8E-2478125IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
MANRKTEVQC LHRWQKVLNP ELIKGPWTQE EDDKIIDLVK KYGATKWSVI ARSLSGRIGK  60
QCRERWHNHL NPEIRKDAWT AEEERALINA HQIYGNKWAE IAKVLPGRTD NSIKNHWNSS  120
LRKKLDIYRT SNVLAVPKLL GHDDFKDKPK QMATEGHLDL SKVSSISSKD LPEITHRSSF  180
SPLRQAHKLE HAKDCSGFLL PTAQPLTSYE VSSIVDSSAV TLAVQGLESD SVRHKGLEID  240
SAHEKGLEVN STPDPVESSG TIQLEAAPSK GEPASPLKNE AHSTLGPLWY QIPNMEATPT  300
SSSLFPEHHT VHQTSEHCRD GILPPIGCTT PSPTNGKISS QLSVDSILKS AANSFPSTPS  360
ILRRRKRDKS TPASASELKS GVNTDSFYTP MGKEPTTDTP ESFKTASFLS LGSLDGLSSS  420
VRSFDVSPPY RTRSKRMAVT KTVEKQLDFS SDGLDTCGSE ILNSPCQNSQ STNSITEAPR  480
MKEKGHNEHV FQLETLTKNF AHTTNLDVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-61512539159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-61512539159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1363368RRKRDK
2430435RTRSKR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in abiotic stress responses (PubMed:17293435, PubMed:19279197). May play a regulatory role in tolerance to salt, cold, and drought stresses (PubMed:17293435). Transcriptional activator that binds specifically to a mitosis-specific activator cis-element 5'-(T/C)C(T/C)AACGG(T/C)(T/C)A-3', found in promoters of cyclin genes such as CYCB1-1 and KNOLLE (AC Q84R43). Positively regulates a subset of G2/M phase-specific genes, including CYCB1-1, CYCB2-1, CYCB2-2, and CDC20.1 in response to cold treatment (PubMed:19279197). {ECO:0000269|PubMed:17293435, ECO:0000269|PubMed:19279197}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000374G0780
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by cold, drought and salt stresses. {ECO:0000269|PubMed:17293435}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616493.10.0transcription factor MYB3R-2
RefseqXP_015616500.10.0transcription factor MYB3R-2
SwissprotQ0JHU70.0MB3R2_ORYSJ; Transcription factor MYB3R-2
TrEMBLA0A0D9YH510.0A0A0D9YH51_9ORYZ; Uncharacterized protein
STRINGOGLUM01G40780.10.0(Oryza glumipatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30993880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.22e-88myb domain protein 3r-5
Publications ? help Back to Top
  1. Kakar KU, et al.
    A consortium of rhizobacterial strains and biochemical growth elicitors improve cold and drought stress tolerance in rice (Oryza sativa L.).
    Plant Biol (Stuttg), 2016. 18(3): p. 471-83
    [PMID:26681628]