PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pahal.E03954.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 173aa MW: 19217.5 Da PI: 6.6836 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 83.6 | 1.2e-26 | 11 | 60 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rie+ rqv fskRr+g++KKA+ELS LCdaeva+i+fs+ gklyey+s Pahal.E03954.1 11 RIEDRVSRQVRFSKRRAGLFKKAFELSLLCDAEVALIVFSPAGKLYEYAS 60 8***********************************************86 PP | |||||||
2 | K-box | 22.3 | 5.4e-09 | 95 | 150 | 26 | 77 |
K-box 26 keienLqreqRhllGedLes....LslkeLqqLeqqLekslkkiRskKnellleqi 77 +e + Lq+++R ++ +L+s + +eL++Le+ L+++l+ RskK++ll +q Pahal.E03954.1 95 DEASDLQSTLREIVTWCLQSnpdeSDANELEKLENLLKNALRDTRSKKMQLLAKQN 150 6667788888888888886522225789************************9996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 4.9E-33 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.072 | 2 | 62 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.70E-40 | 3 | 76 | No hit | No description |
SuperFamily | SSF55455 | 7.06E-30 | 4 | 75 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-27 | 4 | 24 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.6E-25 | 11 | 58 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-27 | 24 | 39 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-27 | 39 | 60 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.6E-5 | 94 | 149 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MPRRGRVELR RIEDRVSRQV RFSKRRAGLF KKAFELSLLC DAEVALIVFS PAGKLYEYAS 60 ASIEDTYDRY QQFAGAAGDE NGDRNGNDPK ISNKDEASDL QSTLREIVTW CLQSNPDESD 120 ANELEKLENL LKNALRDTRS KKMQLLAKQN SGEGTSGQGC NVVAIKQEQG TA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3kov_B | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3kov_I | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3kov_J | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_A | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_B | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_C | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_D | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_I | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_J | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
5f28_A | 2e-18 | 4 | 73 | 3 | 72 | MEF2C |
5f28_B | 2e-18 | 4 | 73 | 3 | 72 | MEF2C |
5f28_C | 2e-18 | 4 | 73 | 3 | 72 | MEF2C |
5f28_D | 2e-18 | 4 | 73 | 3 | 72 | MEF2C |
6byy_A | 3e-18 | 4 | 74 | 3 | 73 | MEF2 CHIMERA |
6byy_B | 3e-18 | 4 | 74 | 3 | 73 | MEF2 CHIMERA |
6byy_C | 3e-18 | 4 | 74 | 3 | 73 | MEF2 CHIMERA |
6byy_D | 3e-18 | 4 | 74 | 3 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269|PubMed:17951465}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HM130525 | 2e-82 | HM130525.1 Hordeum vulgare subsp. vulgare cultivar Igri ODDSOC1 (ODDSOC1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025817550.1 | 1e-124 | MADS-box transcription factor 51-like isoform X1 | ||||
Refseq | XP_025817551.1 | 1e-124 | MADS-box transcription factor 51-like isoform X1 | ||||
Swissprot | Q9XJ61 | 1e-70 | MAD51_ORYSJ; MADS-box transcription factor 51 | ||||
TrEMBL | A0A2S3HXS3 | 1e-123 | A0A2S3HXS3_9POAL; Uncharacterized protein | ||||
STRING | Sb03g044170.1 | 3e-72 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP129 | 38 | 398 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G22950.1 | 1e-30 | AGAMOUS-like 19 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pahal.E03954.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|