PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pahal.C01412.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 138aa MW: 15011.2 Da PI: 10.5421 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 59.8 | 3.5e-19 | 23 | 57 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C+tt Tp+WR gp g+++LCnaCG++yrkk++ Pahal.C01412.1 23 CVECRTTATPMWRGGPTGPRSLCNACGIRYRKKRR 57 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 2.2E-14 | 17 | 74 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 2.23E-13 | 19 | 58 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 8.1E-15 | 22 | 58 | IPR013088 | Zinc finger, NHR/GATA-type |
PROSITE profile | PS50114 | 12.176 | 23 | 53 | IPR000679 | Zinc finger, GATA-type |
CDD | cd00202 | 4.58E-12 | 23 | 58 | No hit | No description |
Pfam | PF00320 | 4.8E-17 | 23 | 57 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 23 | 48 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 138 aa Download sequence Send to blast |
MMDSAEHKVI GIAAAAEPGR PCCVECRTTA TPMWRGGPTG PRSLCNACGI RYRKKRRQEL 60 GLDNNKKPQQ NQQQPHPPQQ PQQPQHQDHS LAPSAVKDNK SSGLQVVKKR RVLMGVEEAA 120 ILLMALSSSS RSTLLHG* |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025807325.1 | 9e-98 | GATA transcription factor 23-like | ||||
TrEMBL | A0A2S3H880 | 2e-96 | A0A2S3H880_9POAL; Uncharacterized protein | ||||
STRING | Si011269m | 3e-59 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6721 | 28 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26930.1 | 9e-21 | GATA transcription factor 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pahal.C01412.1 |