PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pahal.A01874.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 128aa MW: 13782.5 Da PI: 9.5146 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 61.8 | 8.1e-20 | 22 | 56 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C++t+Tp+WR+gp g+++LCnaCG++yrkk++ Pahal.A01874.1 22 CVECRATTTPMWRSGPTGPRSLCNACGIRYRKKRR 56 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 5.9E-15 | 16 | 74 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 13.428 | 16 | 52 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 1.28E-13 | 19 | 58 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 2.8E-16 | 20 | 57 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 3.31E-13 | 21 | 57 | No hit | No description |
Pfam | PF00320 | 1.5E-17 | 22 | 56 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 22 | 47 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009416 | Biological Process | response to light stimulus | ||||
GO:0048527 | Biological Process | lateral root development | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 128 aa Download sequence Send to blast |
MGSADHSEID GIVVAERGAR SCVECRATTT PMWRSGPTGP RSLCNACGIR YRKKRRQELG 60 LDHKQQQQQR SQHNGEATTE VKDSSSSSSG SSNLQAVQKR RLLMGVEEAA LLLMTLSSSP 120 TSTLLHG* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT040389 | 1e-109 | BT040389.1 Zea mays full-length cDNA clone ZM_BFc0088I05 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025814363.1 | 7e-89 | GATA transcription factor 23-like | ||||
Swissprot | Q8LC59 | 9e-18 | GAT23_ARATH; GATA transcription factor 23 | ||||
TrEMBL | A0A2S3HVM7 | 2e-87 | A0A2S3HVM7_9POAL; Uncharacterized protein | ||||
STRING | Pavir.Ea01306.1.p | 5e-72 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6721 | 28 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26930.1 | 1e-18 | GATA transcription factor 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pahal.A01874.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|