PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CCG016109.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 143aa MW: 16394.3 Da PI: 5.0721 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 145.1 | 1.6e-45 | 5 | 99 | 3 | 97 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 +qd++lPianv+r+mk+ lP a++sk+ak+ +qec++efisfvtseas+kc++e+rk++ngdd++wal++lGf+dy+++ yl+kyre+e++k CCG016109.1 5 KQDQLLPIANVGRVMKQRLPPTARVSKEAKQRMQECATEFISFVTSEASNKCRKENRKALNGDDVCWALSSLGFDDYADTTVRYLHKYREAERAK 99 79******************************************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.1E-46 | 4 | 126 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.03E-36 | 6 | 122 | IPR009072 | Histone-fold |
Pfam | PF00808 | 6.2E-23 | 9 | 73 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 3.1E-15 | 37 | 55 | No hit | No description |
PRINTS | PR00615 | 3.1E-15 | 56 | 74 | No hit | No description |
PRINTS | PR00615 | 3.1E-15 | 75 | 93 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MDDDKQDQLL PIANVGRVMK QRLPPTARVS KEAKQRMQEC ATEFISFVTS EASNKCRKEN 60 RKALNGDDVC WALSSLGFDD YADTTVRYLH KYREAERAKA DQKKATDTDK VNKDEESNDT 120 SCQAVQQQTD QIPEPTILEF RFL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 4e-36 | 6 | 94 | 4 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 4e-36 | 6 | 94 | 4 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011023652.1 | 1e-103 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O04027 | 2e-48 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | B9I7Q2 | 3e-99 | B9I7Q2_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0013s02020.1 | 1e-100 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF805 | 32 | 131 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 7e-49 | nuclear factor Y, subunit B4 |
Publications ? help Back to Top | |||
---|---|---|---|
|