PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_39245 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 116aa MW: 13551.6 Da PI: 8.9044 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 32.2 | 2.5e-10 | 14 | 45 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 rg W++eEde+l+++++ +G g+W+ ++ + g PEQU_39245 14 RGLWSPEEDEKLIKYITTHGYGCWSEVPDKAG 45 789************************99887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.2E-23 | 6 | 89 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.394 | 9 | 90 | IPR017930 | Myb domain |
SMART | SM00717 | 7.0E-8 | 13 | 88 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.12E-17 | 16 | 114 | IPR009057 | Homeodomain-like |
Pfam | PF13921 | 1.9E-12 | 17 | 101 | No hit | No description |
CDD | cd00167 | 6.63E-8 | 17 | 86 | No hit | No description |
PROSITE profile | PS50090 | 3.961 | 87 | 116 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 7.9E-9 | 90 | 114 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 116 aa Download sequence Send to blast |
MGHHSCCNQQ KVKRGLWSPE EDEKLIKYIT THGYGCWSEV PDKAGFYNCA FNSNWPQLVA 60 LLVINHIGCR LQRCGKSCRL RWINYLRPDI RRGRFSPEEE KLIISLHAVV GNRFDF |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence (PubMed:12753590, PubMed:17147638, PubMed:17329564). May play a role in specifying early endothecial cell development by regulating a number of genes linked to secondary thickening such as NST1 and NST2. Acts upstream of the lignin biosynthesis pathway (PubMed:17329564). {ECO:0000269|PubMed:12753590, ECO:0000269|PubMed:17147638, ECO:0000269|PubMed:17329564}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by auxin. {ECO:0000269|PubMed:23410518}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013610297.1 | 6e-56 | PREDICTED: transcription factor MYB23 | ||||
Swissprot | Q9SPG3 | 3e-47 | MYB26_ARATH; Transcription factor MYB26 | ||||
TrEMBL | A0A0D3E407 | 1e-54 | A0A0D3E407_BRAOL; Uncharacterized protein | ||||
STRING | Bo9g029530.1 | 2e-55 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6032 | 37 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G63910.1 | 2e-55 | myb domain protein 103 |
Publications ? help Back to Top | |||
---|---|---|---|
|