PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_33205 | ||||||||
Common Name | SEP1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 244aa MW: 28192 Da PI: 9.0897 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97.5 | 5.6e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLC+aeva+iifs++gklye++s PEQU_33205 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFCS 59 79***********************************************96 PP | |||||||
2 | K-box | 101 | 1.6e-33 | 83 | 173 | 10 | 100 |
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 +++++s+qqe+ kLk+++e Lqr+qR+llGedL++L+ keL+qLe+qL++slk+iRs++++++l+q+ +lq++e++l e+nk+L+++lee PEQU_33205 83 ISRETQSSQQEYLKLKSRVEALQRSQRNLLGEDLGPLNSKELEQLERQLDNSLKQIRSTRTQFMLDQLADLQRREQMLCEANKTLKRRLEE 173 56789**********************************************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.0E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.039 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.58E-33 | 2 | 86 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.34E-44 | 2 | 76 | No hit | No description |
PRINTS | PR00404 | 4.4E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.6E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.4E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.4E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.1E-26 | 85 | 171 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.417 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0001708 | Biological Process | cell fate specification | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010093 | Biological Process | specification of floral organ identity | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0048833 | Biological Process | specification of floral organ number | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 244 aa Download sequence Send to blast |
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCE AEVALIIFSN RGKLYEFCSS 60 SSMLKTLERY QKNNYGAPET NIISRETQSS QQEYLKLKSR VEALQRSQRN LLGEDLGPLN 120 SKELEQLERQ LDNSLKQIRS TRTQFMLDQL ADLQRREQML CEANKTLKRR LEESNQANPQ 180 QIWDPSTAHA MGYDQRQPVQ PHGEAFYHPL ECEPTLHIGY HSDLSIAPMA APNVNNYMPP 240 GWLA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4ox0_A | 4e-41 | 75 | 171 | 1 | 101 | Developmental protein SEPALLATA 3 |
4ox0_B | 4e-41 | 75 | 171 | 1 | 101 | Developmental protein SEPALLATA 3 |
4ox0_C | 4e-41 | 75 | 171 | 1 | 101 | Developmental protein SEPALLATA 3 |
4ox0_D | 4e-41 | 75 | 171 | 1 | 101 | Developmental protein SEPALLATA 3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor active in inflorescence development and floral organogenesis. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00605 | ChIP-seq | Transfer from AT1G24260 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF673857 | 0.0 | KF673857.1 Phalaenopsis equestris SEPALLATA-like MADS-box protein 1 (SEP1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020599713.1 | 0.0 | agamous-like MADS-box protein AGL9 homolog isoform X2 | ||||
Swissprot | Q38694 | 1e-155 | AGL9_ARADE; Agamous-like MADS-box protein AGL9 homolog | ||||
TrEMBL | X5CQZ9 | 0.0 | X5CQZ9_PHAEQ; SEPALLATA-like MADS-box protein 1 | ||||
STRING | XP_008801850.1 | 1e-142 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3483 | 34 | 69 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G24260.1 | 1e-111 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|