PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_32690 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 99aa MW: 11830.3 Da PI: 9.9905 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 93.9 | 1.2e-29 | 31 | 88 | 1 | 58 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 ldDgy+WrKYG+K+vk+s +pr+YYrC+++gC+vkk++er +ed +v++ Yeg Hnh PEQU_32690 31 LDDGYKWRKYGKKMVKSSSNPRNYYRCSMEGCNVKKRIERMEEDSGYVITSYEGIHNH 88 59******************************************************** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 6.9E-31 | 16 | 89 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 9.81E-27 | 24 | 89 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 27.6 | 26 | 91 | IPR003657 | WRKY domain |
SMART | SM00774 | 6.6E-31 | 31 | 90 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.2E-22 | 32 | 88 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 99 aa Download sequence Send to blast |
WMCRNTNMQQ SNQRLKKTKV SFKTKSDRDV LDDGYKWRKY GKKMVKSSSN PRNYYRCSME 60 GCNVKKRIER MEEDSGYVIT SYEGIHNHYA LNQHDYSGT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-23 | 22 | 88 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 2e-23 | 22 | 88 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020598279.1 | 1e-65 | probable WRKY transcription factor 50 | ||||
Swissprot | Q8VWQ5 | 1e-32 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A2P1JML1 | 5e-53 | A0A2P1JML1_9ASPA; WRKY transcription factor 50-like (Fragment) | ||||
STRING | Traes_3B_E408A7B56.1 | 2e-34 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP441 | 37 | 206 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 6e-35 | WRKY DNA-binding protein 50 |
Publications ? help Back to Top | |||
---|---|---|---|
|