PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_26527 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 161aa MW: 18502.4 Da PI: 10.2099 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 134.6 | 6.6e-42 | 15 | 145 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyat.gkrknratksgyWkatgkdkevlsk.. 95 lppGfrFhPtdeelvv+yL++k+ + +l++ +i+e+d+ k++PwdLp ++ + + ++++f+ +++k++++ g+ + r tk gyWk gk+k+vl++ PEQU_26527 15 LPPGFRFHPTDEELVVQYLRRKAFSFPLPA-AIIPEIDLGKLNPWDLPLNLGGfGGDKYFFYLRESKSQKKkGRVSYRETKLGYWKPLGKEKPVLASsq 112 79***************************9.88***************666552444555555555555542556678*****************9877 PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 ++elvglk++L+fy+g++p+g+ktdW+mhey+l PEQU_26527 113 GNELVGLKQVLAFYRGKSPHGSKTDWIMHEYSL 145 7888***************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.76E-45 | 9 | 150 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 44.659 | 15 | 161 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.2E-23 | 16 | 145 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 161 aa Download sequence Send to blast |
EMERNEFMKH GLVRLPPGFR FHPTDEELVV QYLRRKAFSF PLPAAIIPEI DLGKLNPWDL 60 PLNLGGFGGD KYFFYLRESK SQKKKGRVSY RETKLGYWKP LGKEKPVLAS SQGNELVGLK 120 QVLAFYRGKS PHGSKTDWIM HEYSLPNKEL LKSSAQVSAN Y |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 3e-34 | 4 | 145 | 4 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020578085.1 | 1e-111 | NAC domain-containing protein 83-like | ||||
Swissprot | Q9FY93 | 2e-52 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A2I0WHH1 | 5e-93 | A0A2I0WHH1_9ASPA; NAC transcription factor NAM-2 | ||||
STRING | XP_008813225.1 | 2e-61 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6317 | 32 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 7e-55 | NAC domain containing protein 83 |
Publications ? help Back to Top | |||
---|---|---|---|
|