PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_25174 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 85aa MW: 9642.95 Da PI: 8.5174 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 26.8 | 9.3e-09 | 12 | 51 | 15 | 54 |
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 +iN+ +++L++llP++ + + +++s + L+++++YIk+L PEQU_25174 12 EINELISKLQSLLPESRRRSVGRVSASKLLKETCNYIKNL 51 7**************77999******************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50888 | 10.34 | 1 | 51 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene3D | G3DSA:4.10.280.10 | 6.4E-10 | 11 | 65 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
SuperFamily | SSF47459 | 4.32E-9 | 11 | 69 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Pfam | PF00010 | 4.1E-6 | 12 | 51 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 85 aa Download sequence Send to blast |
MSSRRSRITE AEINELISKL QSLLPESRRR SVGRVSASKL LKETCNYIKN LHQEIDDLSE 60 RLSGLINNMD GESAEAEIVR SLLRS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic basic helix-loop-helix transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea (By similarity). {ECO:0000250}. | |||||
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic basic helix-loop-helix transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. {ECO:0000269|PubMed:23136524}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020583254.1 | 9e-53 | transcription factor ILI5-like | ||||
Swissprot | A2X9L8 | 3e-30 | ILI5_ORYSI; Transcription factor ILI5 | ||||
Swissprot | Q6YUX0 | 3e-30 | ILI5_ORYSJ; Transcription factor ILI5 | ||||
TrEMBL | A0A2I0W707 | 3e-41 | A0A2I0W707_9ASPA; Transcription factor bHLH135 | ||||
STRING | XP_008803188.1 | 2e-38 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP928 | 38 | 145 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G26945.1 | 6e-23 | bHLH family protein |