PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_17357 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 223aa MW: 25247.8 Da PI: 7.5875 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 103.3 | 1.4e-32 | 61 | 114 | 2 | 55 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+ PEQU_17357 61 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 114 9****************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 8.24E-16 | 58 | 114 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 6.0E-29 | 59 | 114 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 3.8E-24 | 61 | 114 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 2.8E-7 | 62 | 113 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009887 | Biological Process | organ morphogenesis | ||||
GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
GO:0009956 | Biological Process | radial pattern formation | ||||
GO:0010051 | Biological Process | xylem and phloem pattern formation | ||||
GO:0010158 | Biological Process | abaxial cell fate specification | ||||
GO:0010229 | Biological Process | inflorescence development | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 223 aa Download sequence Send to blast |
MPANSAKFYN QSYDYHQLFH HHHHHQQQQQ QFGFGGFEAP GSLMRSRLMS KITTKRSMRA 60 PRMRWTSTLH ARFVHAVELL GGHERATPKS VLELMDVKDL TLAHVKSHLQ MYRTVKTTDK 120 AAASSGQSDG SGDEDPNFRR LLDNRGAHDT DSASKWTNSS SRGAWLHSNA SEMEDLRPAN 180 FSSEADCNVT SSPTDSPRSL KEFENPSLEF TLGRPDWHSS EHD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4k_A | 2e-16 | 62 | 116 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4k_B | 2e-16 | 62 | 116 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_A | 1e-16 | 62 | 116 | 3 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_B | 1e-16 | 62 | 116 | 3 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_C | 1e-16 | 62 | 116 | 3 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_D | 1e-16 | 62 | 116 | 3 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_A | 2e-16 | 62 | 116 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_C | 2e-16 | 62 | 116 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_D | 2e-16 | 62 | 116 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_F | 2e-16 | 62 | 116 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_H | 2e-16 | 62 | 116 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_J | 2e-16 | 62 | 116 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}. | |||||
UniProt | Transcriptional repressor that regulates lateral organ polarity. Promotes lateral organ abaxial identity by repressing the adaxial regulator ASYMMETRIC LEAVES2 (AS2) in abaxial cells. Required for abaxial identity in both leaves and carpels. Functions with KAN2 in the specification of polarity of the ovule outer integument. Regulates cambium activity by repressing the auxin efflux carrier PIN1. Plays a role in lateral root formation and development. {ECO:0000269|PubMed:11395775, ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:14561401, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928, ECO:0000269|PubMed:18849474, ECO:0000269|PubMed:20179097}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by AS2 in adaxial tissue. {ECO:0000269|PubMed:18849474}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM661300 | 4e-54 | KM661300.1 Ananas bracteatus clone 43011 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020573274.1 | 1e-164 | LOW QUALITY PROTEIN: probable transcription factor RL9 | ||||
Swissprot | Q0J235 | 1e-53 | ROLL9_ORYSJ; Probable transcription factor RL9 | ||||
Swissprot | Q93WJ9 | 2e-54 | KAN1_ARATH; Transcription repressor KAN1 | ||||
TrEMBL | A0A2I0WCU4 | 1e-102 | A0A2I0WCU4_9ASPA; Transcription repressor KAN1 | ||||
STRING | XP_008775090.1 | 9e-79 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2558 | 37 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G16560.1 | 4e-49 | G2-like family protein |