PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_12328 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 140aa MW: 16079.5 Da PI: 9.749 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 76.8 | 1.7e-24 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 kri++ +nrqvtfskRr g+lKKA+EL vL+da+v v+ifs +g+ly y PEQU_12328 9 KRIDSITNRQVTFSKRRGGLLKKAHELAVLTDARVGVMIFSASGRLYQYN 58 79**********************************************96 PP | |||||||
2 | K-box | 54 | 7.1e-19 | 83 | 140 | 12 | 69 |
K-box 12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69 + ++ lq elak+k+ ++ Lq ++R++ GedL+ L++++L+ Le+qL+ s++kiR++K PEQU_12328 83 NSHQLLQFELAKIKQDTHVLQASIRQFTGEDLTGLTINDLNLLEEQLDYSVSKIRTRK 140 568999***************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.9E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.857 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 6.15E-29 | 2 | 86 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.33E-37 | 2 | 79 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.8E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.0E-22 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.8E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.8E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.8E-15 | 83 | 140 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 11.088 | 85 | 140 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0019252 | Biological Process | starch biosynthetic process | ||||
GO:0043068 | Biological Process | positive regulation of programmed cell death | ||||
GO:0048316 | Biological Process | seed development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 140 aa Download sequence Send to blast |
MGRGKIEIKR IDSITNRQVT FSKRRGGLLK KAHELAVLTD ARVGVMIFSA SGRLYQYNSP 60 GESMERIIED YLKVHHIQLE DLNSHQLLQF ELAKIKQDTH VLQASIRQFT GEDLTGLTIN 120 DLNLLEEQLD YSVSKIRTRK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 9e-18 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 9e-18 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 9e-18 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 9e-18 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_A | 9e-18 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 9e-18 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 9e-18 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 9e-18 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 9e-18 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 9e-18 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020586349.1 | 5e-97 | MADS-box protein ZMM17-like | ||||
Swissprot | Q8VWM8 | 3e-51 | M17_MAIZE; MADS-box protein ZMM17 | ||||
TrEMBL | A0A455LA46 | 6e-66 | A0A455LA46_9ASPA; MADS-box protein-like protein (Fragment) | ||||
STRING | GSMUA_Achr3P23580_001 | 3e-55 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1850 | 37 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37940.1 | 3e-40 | AGAMOUS-like 21 |