PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_10162 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 106aa MW: 11816.9 Da PI: 10.4792 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 61.6 | 1.6e-19 | 7 | 86 | 19 | 98 |
NF-YC 19 helPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98 +++P +rikki++adedv +i+ +P l+ska elf+ +l r++ + ++ +tl+ ++++v+ fdfl+ +v + PEQU_10162 7 TRFPASRIKKIMQADEDVGKIALAVPLLVSKALELFLQDLCNRTYEVTLQSGAKTLNSLHLKQCVKMYSAFDFLTAVVNK 86 579***********************************************************************998876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 6.46E-19 | 3 | 87 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 5.2E-26 | 3 | 72 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.2E-19 | 8 | 71 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 106 aa Download sequence Send to blast |
MRKKLGTRFP ASRIKKIMQA DEDVGKIALA VPLLVSKALE LFLQDLCNRT YEVTLQSGAK 60 TLNSLHLKQC VKMYSAFDFL TAVVNKVPTL GGTESFGDEK GITRRR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1jfi_A | 2e-23 | 2 | 73 | 5 | 76 | Transcription Regulator NC2 alpha chain |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020586770.1 | 2e-72 | dr1-associated corepressor-like isoform X1 | ||||
Refseq | XP_020586771.1 | 2e-72 | dr1-associated corepressor-like isoform X2 | ||||
Swissprot | Q2YDP3 | 4e-28 | NC2A_BOVIN; Dr1-associated corepressor | ||||
TrEMBL | A0A2I0W1E1 | 7e-65 | A0A2I0W1E1_9ASPA; Nuclear transcription factor Y subunit C-3 | ||||
STRING | XP_008782237.1 | 2e-64 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2172 | 36 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G12480.1 | 1e-51 | nuclear factor Y, subunit C11 |