PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_06885 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 126aa MW: 14043.1 Da PI: 8.7499 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 131.2 | 4.4e-41 | 21 | 119 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 +Ca+Ck+lrrkC++dCv+apyfp +qp kf nvh++FGasnv+k+l++l++ ereda++sl+yeAe+r+rdPvyG++g+ + lq+ql++l+ +l+++++ PEQU_06885 21 PCAGCKFLRRKCQPDCVFAPYFPPDQPTKFSNVHRVFGASNVTKILNDLKPFEREDAVNSLAYEAEMRLRDPVYGCAGI-SLLQRQLRELQIDLSRARS 118 7****************************************************************************95.78*************9988 PP DUF260 100 e 100 e PEQU_06885 119 E 119 7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 24.245 | 20 | 120 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.5E-40 | 21 | 117 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009799 | Biological Process | specification of symmetry | ||||
GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
GO:0009954 | Biological Process | proximal/distal pattern formation | ||||
GO:0048441 | Biological Process | petal development | ||||
GO:0005654 | Cellular Component | nucleoplasm |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 126 aa Download sequence Send to blast |
NVLTIPTPPT MASGGHTVSS PCAGCKFLRR KCQPDCVFAP YFPPDQPTKF SNVHRVFGAS 60 NVTKILNDLK PFEREDAVNS LAYEAEMRLR DPVYGCAGIS LLQRQLRELQ IDLSRARSEL 120 VKYQSA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-51 | 9 | 123 | 3 | 114 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-51 | 9 | 123 | 3 | 114 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Promotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00211 | DAP | Transfer from AT1G65620 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020702209.1 | 5e-66 | protein ASYMMETRIC LEAVES 2 | ||||
Refseq | XP_020702210.1 | 5e-66 | protein ASYMMETRIC LEAVES 2 | ||||
Refseq | XP_020702211.1 | 5e-66 | protein ASYMMETRIC LEAVES 2 | ||||
Swissprot | Q32SG3 | 6e-59 | LBD6_MAIZE; LOB domain-containing protein 6 | ||||
TrEMBL | A0A2I0VVY1 | 1e-64 | A0A2I0VVY1_9ASPA; LOB domain-containing protein 6 | ||||
STRING | VIT_00s0340g00090.t01 | 3e-58 | (Vitis vinifera) | ||||
STRING | Pavir.J03307.1.p | 5e-58 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2267 | 38 | 95 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G65620.4 | 7e-56 | LBD family protein |