PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_03031 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 94aa MW: 10523.2 Da PI: 5.7814 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 35.3 | 2.7e-11 | 14 | 45 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g+WT+eEd +lv +++++G+g+W++++ g PEQU_03031 14 KGPWTPEEDIILVSYIQEHGPGNWRAVPTNTG 45 79************************998765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 9.5E-14 | 5 | 43 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.36E-9 | 9 | 44 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 10.585 | 9 | 62 | IPR017930 | Myb domain |
SMART | SM00717 | 0.0092 | 13 | 60 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-9 | 14 | 43 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.28E-7 | 16 | 48 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 94 aa Download sequence Send to blast |
MGRPPCCEKE GVKKGPWTPE EDIILVSYIQ EHGPGNWRAV PTNTGKEIPL FSSFLTLFLP 60 IRSCGSVSVS KIVITGQDLS DFSVIFWFYF LSLI |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP229 | 38 | 296 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62470.1 | 9e-29 | myb domain protein 96 |