PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G62470.1

Common Name

ATMYB96, MYB96, MYBCOV1

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 351aa MW: 39031.3 Da PI: 5.8446

Description

myb domain protein 96

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G62470.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	57.9	2.4e-18	14	60	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +lv +++++G+g+W++++ + g R+ k+c++rw +yl AT5G62470.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTHTG-LRCSKSCRLRWTNYL 60 79****************************.9**********97 PP
2	Myb_DNA-binding	50	7.1e-16	66	111	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+ E++ +v++ ++lG++ W++Ia++++ Rt++++k++w+++l AT5G62470.1 66 RGNFTEHEEKTIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 111 89******************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.788	9	64	IPR017930	Myb domain
SuperFamily	SSF46689	2.64E-30	11	107	IPR009057	Homeodomain-like
SMART	SM00717	9.3E-16	13	62	IPR001005	SANT/Myb domain
Pfam	PF00249	1.6E-17	14	60	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	9.1E-25	15	67	IPR009057	Homeodomain-like
CDD	cd00167	2.50E-13	16	60	No hit	No description
SMART	SM00717	1.7E-15	65	113	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	19.275	65	115	IPR017930	Myb domain
Pfam	PF00249	3.3E-14	66	111	IPR001005	SANT/Myb domain
CDD	cd00167	7.73E-11	68	111	No hit	No description
Gene3D	G3DSA:1.10.10.60	3.8E-24	68	116	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009414	Biological Process	response to water deprivation
GO:0009651	Biological Process	response to salt stress
GO:0009737	Biological Process	response to abscisic acid
GO:0009751	Biological Process	response to salicylic acid
GO:0010468	Biological Process	regulation of gene expression
GO:0030154	Biological Process	cell differentiation
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000027	anatomy	lateral root tip
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 351 aa Download sequence Send to blast
MGRPPCCEKI GVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTHTGLRCSK SCRLRWTNYL 60 RPGIKRGNFT EHEEKTIVHL QALLGNRWAA IASYLPERTD NDIKNYWNTH LKKKLKKINE 120 SGEEDNDGVS SSNTSSQKNH QSTNKGQWER RLQTDINMAK QALCEALSLD KPSSTLSSSS 180 SLPTPVITQQ NIRNFSSALL DRCYDPSSSS SSTTTTTTSN TTNPYPSGVY ASSAENIARL 240 LQDFMKDTPK ALTLSSSSPV SETGPLTAAV SEEGGEGFEQ SFFSFNSMDE TQNLTQETSF 300 FHDQVIKPEI TMDQDHGLIS QGSLSLFEKW LFDEQSHEMV GMALAGQEGM F

Sequence ? help Back to Top

Protein Sequence Length: 351 aa Download sequence Send to blast

MGRPPCCEKI GVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTHTGLRCSK SCRLRWTNYL  60
RPGIKRGNFT EHEEKTIVHL QALLGNRWAA IASYLPERTD NDIKNYWNTH LKKKLKKINE  120
SGEEDNDGVS SSNTSSQKNH QSTNKGQWER RLQTDINMAK QALCEALSLD KPSSTLSSSS  180
SLPTPVITQQ NIRNFSSALL DRCYDPSSSS SSTTTTTTSN TTNPYPSGVY ASSAENIARL  240
LQDFMKDTPK ALTLSSSSPV SETGPLTAAV SEEGGEGFEQ SFFSFNSMDE TQNLTQETSF  300
FHDQVIKPEI TMDQDHGLIS QGSLSLFEKW LFDEQSHEMV GMALAGQEGM F

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1mse_C	3e-28	14	115	4	105	C-Myb DNA-Binding Domain
1msf_C	3e-28	14	115	4	105	C-Myb DNA-Binding Domain
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.9303	0.0	flower\| seed

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	247455_at	0.0
Expression Atlas	AT5G62470	-
AtGenExpress	AT5G62470	-
ATTED-II	AT5G62470	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in leaves, flowers, guard cells and lateral root primordia. {ECO:0000269\|PubMed:19625633}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a R2R3 type Myb transcription factor whose expression is strongly induced by abscisic acid. Mediates abscisic acid signaling during drought stress response.
UniProt	Transcription activator involved in the activation of cuticular wax biosynthesis under drought stress. Binds directly to DNA consensus sequences found in the promoters of genes encoding very-long-chain fatty acid-condensing enzymes involved in cuticular wax biosynthesis (PubMed:21398568). Functions together with MYB94 in the activation of cuticular wax biosynthesis (PubMed:27577115). Involved in drought stress response through abscisic acid (ABA) signaling. Mediates ABA signals that enhance plant resistance to drought by reducing stomatal opening. Mediates ABA-auxin cross-talk to regulate lateral root growth under drought stress conditions (PubMed:19625633). Involved in the regulation of ABA biosynthesis and ABA-dependent seed dormancy state. Binds to the promoters of NCED2 and NCED6, which are enzymes catalyzing the first step of ABA biosynthesis (PubMed:25616734). Regulates seed germination by controlling the expression of ABI4, a repressor of lipid breakdown during seed germination (PubMed:25869652). Binds to the promoter of LTP3 and transactivates LTP3 gene in response to drought stress and freezing (PubMed:23404903). Involved in cold stress response. Binds directly to the promoters of heptahelical protein (HHP) genes in response to cold stress. HHPs modulate the expression of SCRM/ICE1, SCRM2/ICE2 and CAMTA3, which are upstream regulators of cold-responsive C-repeat-binding factors (CBFs) (PubMed:25912720). Involved in defense responses against the bacterial pathogen Pseudomonas syringae. May act as a molecular link that mediates cross-talks between ABA and salicylate (PubMed:20149112). Involved in a crosstalk between the circadian clock and ABA signaling. Binds directly to the promoter of APRR1/TOC1 to activate its expression (PubMed:26725725). {ECO:0000269\|PubMed:19625633, ECO:0000269\|PubMed:20149112, ECO:0000269\|PubMed:21398568, ECO:0000269\|PubMed:23404903, ECO:0000269\|PubMed:25616734, ECO:0000269\|PubMed:25869652, ECO:0000269\|PubMed:25912720, ECO:0000269\|PubMed:26725725, ECO:0000269\|PubMed:27577115}.

Function -- GeneRIF ? help Back to Top
It was proposed that MYB96 is a molecular link that mediates abscisic acid-auxin cross talk in drought stress response and lateral root growth, providing an adaptive strategy under drought stress conditions. [PMID: 19625633] MYB96 is a molecular link that mediates abscisic acid-salicylic acid crosstalks. [PMID: 20149112] Activation of cuticular wax biosynthesis by drought and abscisic acid requires MYB96. [PMID: 21398568] MYB96 directly regulates LTP3 expression. [PMID: 23404903] Transgenic Camelina plants overexpressing Arabidopsis MYB96 enhanced tolerance to drought. Deposition of epicuticular wax crystals and total wax loads increased significantly on the surfaces of transgenic leaves. [PMID: 24880908] The Arabidopsis MYB96 transcription factor plays a role in seed dormancy. [PMID: 25616734] MYB96-ABI4 module regulates lipid mobilization specifically in the embryo to ensure proper seed germination under suboptimal conditions. [PMID: 25869652] MYB96 is induced by cold stress in an abscisic acid -independent manner and subsequently activates freezing tolerance. [PMID: 25912720] MYB96 integrates a multitude of environmental stress signals and acts as a master regulator in the determination of timing for seed germination. [PMID: 26313409] MYB96 regulates abscisic acid gated induction of TOC1. [PMID: 26725725] The data collectively indicate that MYB94 and MYB96 exert an additive effect on cuticular wax biosynthesis, which may represent an efficient adaptive mechanism of response to drought in plants. [PMID: 27577115] This study showed that ABA regulates the expression of MYB30-responsive genes during pathogen infection and this regulation is partly dependent on MIEL1. [PMID: 27615387] MYB30-INTERACTING E3 LIGASE 1 (MIEL1) E3 ubiquitin ligase controls the protein stability of the two MYB transcription factors, MYB96 and MYB30, and thereby wax biosynthesis in Arabidopsis. These observations indicate that the MIEL1-MYB96 module is important for balanced cuticular wax biosynthesis in developing inflorescence stems. [PMID: 28838126] MYB96 is a crucial regulator of triacylglycerol accumulation during seed maturation, which transcriptionally activates DGAT1 and PDAT1. The MYB96 gene is highly expressed in developing seeds and positively regulates triacylglycerol biosynthesis in seeds. [PMID: 29660088] MYB96 interacts with the histone modifier HDA15 to suppress negative regulators of early abscisic acid signaling [PMID: 30979883]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00579	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G62470.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA) (PubMed:19625633). Induced by infection with the cauliflower mosaic virus (CaMV) (PubMed:10226370). Induced by cold stress (PubMed:25912720). {ECO:0000269\|PubMed:10226370, ECO:0000269\|PubMed:19625633, ECO:0000269\|PubMed:25912720}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G62470

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF176001	0.0	AF176001.1 Arabidopsis thaliana putative transcription factor (MYB96) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_851248.1	0.0	myb domain protein 96
Swissprot	Q24JK1	0.0	MYB96_ARATH; Transcription factor MYB96
TrEMBL	A0A178UF54	0.0	A0A178UF54_ARATH; MYBCOV1
STRING	AT5G62470.2	0.0	(Arabidopsis thaliana)

Link Out ? help Back to Top
Phytozome	AT5G62470.1
Entrez Gene	836367
iHOP	AT5G62470
wikigenes	AT5G62470

Publications ? help Back to Top
Geri C,Cecchini E,Giannakou ME,Covey SN,Milner JJ Altered patterns of gene expression in Arabidopsis elicited by cauliflower mosaic virus (CaMV) infection and by a CaMV gene VI transgene. Mol. Plant Microbe Interact., 1999. 12(5): p. 377-84 [PMID:10226370] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Leonhardt N, et al. Microarray expression analyses of Arabidopsis guard cells and isolation of a recessive abscisic acid hypersensitive protein phosphatase 2C mutant. Plant Cell, 2004. 16(3): p. 596-615 [PMID:14973164] Tepperman JM, et al. Expression profiling of phyB mutant demonstrates substantial contribution of other phytochromes to red-light-regulated gene expression during seedling de-etiolation. Plant J., 2004. 38(5): p. 725-39 [PMID:15144375] Devoto A, et al. Expression profiling reveals COI1 to be a key regulator of genes involved in wound- and methyl jasmonate-induced secondary metabolism, defence, and hormone interactions. Plant Mol. Biol., 2005. 58(4): p. 497-513 [PMID:16021335] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Seo PJ, et al. The MYB96 transcription factor mediates abscisic acid signaling during drought stress response in Arabidopsis. Plant Physiol., 2009. 151(1): p. 275-89 [PMID:19625633] Seo PJ,Park CM Auxin homeostasis during lateral root development under drought condition. Plant Signal Behav, 2009. 4(10): p. 1002-4 [PMID:19826230] Seo PJ,Park CM MYB96-mediated abscisic acid signals induce pathogen resistance response by promoting salicylic acid biosynthesis in Arabidopsis. New Phytol., 2010. 186(2): p. 471-83 [PMID:20149112] Seo PJ, et al. The MYB96 transcription factor regulates cuticular wax biosynthesis under drought conditions in Arabidopsis. Plant Cell, 2011. 23(3): p. 1138-52 [PMID:21398568] Seo PJ,Park CM Cuticular wax biosynthesis as a way of inducing drought resistance. Plant Signal Behav, 2011. 6(7): p. 1043-5 [PMID:21617381] Meinke DW A survey of dominant mutations in Arabidopsis thaliana. Trends Plant Sci., 2013. 18(2): p. 84-91 [PMID:22995285] Guo L,Yang H,Zhang X,Yang S Lipid transfer protein 3 as a target of MYB96 mediates freezing and drought stress in Arabidopsis. J. Exp. Bot., 2013. 64(6): p. 1755-67 [PMID:23404903] Efroni I, et al. Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] Li-Beisson Y, et al. Acyl-lipid metabolism. Arabidopsis Book, 2013. 11: p. e0161 [PMID:23505340] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Lee SB,Kim H,Kim RJ,Suh MC Overexpression of Arabidopsis MYB96 confers drought resistance in Camelina sativa via cuticular wax accumulation. Plant Cell Rep., 2014. 33(9): p. 1535-46 [PMID:24880908] Lee HG,Lee K,Seo PJ The Arabidopsis MYB96 transcription factor plays a role in seed dormancy. Plant Mol. Biol., 2015. 87(4-5): p. 371-81 [PMID:25616734] Lee K,Lee HG,Yoon S,Kim HU,Seo PJ The Arabidopsis MYB96 Transcription Factor Is a Positive Regulator of ABSCISIC ACID-INSENSITIVE4 in the Control of Seed Germination. Plant Physiol., 2015. 168(2): p. 677-89 [PMID:25869652] Lee HG,Seo PJ The MYB96-HHP module integrates cold and abscisic acid signaling to activate the CBF-COR pathway in Arabidopsis. Plant J., 2015. 82(6): p. 962-77 [PMID:25912720] Lee K,Seo PJ Coordination of seed dormancy and germination processes by MYB96. Plant Signal Behav, 2015. 10(9): p. e1056423 [PMID:26313409] Lee HG,Mas P,Seo PJ MYB96 shapes the circadian gating of ABA signaling in Arabidopsis. Sci Rep, 2016. 6: p. 17754 [PMID:26725725] Cui F, et al. Dissecting Abscisic Acid Signaling Pathways Involved in Cuticle Formation. Mol Plant, 2016. 9(6): p. 926-38 [PMID:27060495] Lee HG,Choi YR,Seo PJ Increased STM expression is associated with drought tolerance in Arabidopsis. J. Plant Physiol., 2016. 201: p. 79-84 [PMID:27448723] Lee SB,Kim HU,Suh MC MYB94 and MYB96 Additively Activate Cuticular Wax Biosynthesis in Arabidopsis. Plant Cell Physiol., 2016. 57(11): p. 2300-2311 [PMID:27577115] Lee HG,Seo PJ The Arabidopsis MIEL1 E3 ligase negatively regulates ABA signalling by promoting protein turnover of MYB96. Nat Commun, 2016. 7: p. 12525 [PMID:27615387] Li P, et al. The Arabidopsis UGT87A2, a stress-inducible family 1 glycosyltransferase, is involved in the plant adaptation to abiotic stresses. Physiol Plant, 2017. 159(4): p. 416-432 [PMID:27747895] Lee HG,Kim J,Suh MC,Seo PJ The MIEL1 E3 Ubiquitin Ligase Negatively Regulates Cuticular Wax Biosynthesis in Arabidopsis Stems. Plant Cell Physiol., 2017. 58(7): p. 1249-1259 [PMID:28838126] Lee HG,Kim H,Suh MC,Kim HU,Seo PJ The MYB96 Transcription Factor Regulates Triacylglycerol Accumulation by Activating DGAT1 and PDAT1 Expression in Arabidopsis Seeds. Plant Cell Physiol., 2018. 59(7): p. 1432-1442 [PMID:29660088] Lee HG,Seo PJ MYB96 recruits the HDA15 protein to suppress negative regulators of ABA signaling in Arabidopsis. Nat Commun, 2019. 10(1): p. 1713 [PMID:30979883]