PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_02109 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 198aa MW: 23399.1 Da PI: 9.713 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.9 | 2.3e-18 | 10 | 55 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l ++v+q+G+ +W++Ia++++ gR++k+c++rw++ PEQU_02109 10 RGHWRPAEDEKLTQLVQQFGPQNWNSIAQKLQ-GRSGKSCRLRWFNQ 55 899*****************************.***********996 PP | |||||||
2 | Myb_DNA-binding | 58 | 2.2e-18 | 62 | 105 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r ++T+eE+e lv a++ +G++ W++Iar ++ gRt++ +k++w+ PEQU_02109 62 RRPFTEEEEETLVTAHRFHGNK-WALIARLFP-GRTDNAVKNHWHV 105 679*******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.94 | 5 | 56 | IPR017930 | Myb domain |
SMART | SM00717 | 6.8E-14 | 9 | 58 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 9.36E-30 | 9 | 103 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.3E-17 | 10 | 55 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-27 | 11 | 63 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.01E-12 | 13 | 54 | No hit | No description |
PROSITE profile | PS51294 | 25.653 | 57 | 111 | IPR017930 | Myb domain |
SMART | SM00717 | 2.2E-15 | 61 | 109 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.9E-15 | 62 | 104 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.3E-21 | 64 | 109 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.36E-6 | 73 | 104 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 198 aa Download sequence Send to blast |
MGEERKLCPR GHWRPAEDEK LTQLVQQFGP QNWNSIAQKL QGRSGKSCRL RWFNQLDPRI 60 NRRPFTEEEE ETLVTAHRFH GNKWALIARL FPGRTDNAVK NHWHVIMARR QRQKSKFFLT 120 KECYQNQIFS TQFHNFNYDF GLMESSDHHR QAQKLSNSSN TYWRFGGLDE HNQEEKDDDG 180 SVKSKGVAYI DFLGVGKD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 3e-33 | 10 | 110 | 4 | 104 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 1e-32 | 10 | 110 | 58 | 158 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 1e-32 | 10 | 110 | 58 | 158 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 2e-33 | 7 | 110 | 1 | 104 | C-Myb DNA-Binding Domain |
1msf_C | 2e-33 | 7 | 110 | 1 | 104 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269|PubMed:20305120}. | |||||
UniProt | Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}. | |||||
UniProt | INDUCTION: Induced by wounding. {ECO:0000269|PubMed:20305120}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020600073.1 | 1e-149 | transcription factor MYB52-like | ||||
Swissprot | Q5NBM8 | 9e-64 | CSA_ORYSJ; Transcription factor CSA | ||||
Swissprot | Q6R0C4 | 1e-64 | MYB52_ARATH; Transcription factor MYB52 | ||||
TrEMBL | A0A2I0W561 | 4e-92 | A0A2I0W561_9ASPA; Transcription factor MYB44 | ||||
STRING | XP_009769218.1 | 2e-70 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP294 | 38 | 260 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G17950.1 | 6e-67 | myb domain protein 52 |