PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PDK_30s787421g001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 142aa MW: 16201.7 Da PI: 10.143 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 62 | 1.2e-19 | 50 | 95 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g WT eEd+ l +av+q+ g++Wk+Ia+ ++ gRt+ qc+srw + PDK_30s787421g001 50 KGGWTDEEDDMLTKAVRQFNGKNWKKIAELFP-GRTDLQCRSRWKRV 95 688*****************************.***********976 PP | |||||||
2 | Myb_DNA-binding | 51.7 | 2e-16 | 102 | 142 | 1 | 43 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 +g WT+eEd+l++++v+++G + W+ Ia+ ++ gR +kqc++r PDK_30s787421g001 102 KGTWTKEEDDLIIQLVEKHGCK-WSVIAKSLP-GRIGKQCQDR 142 799*****************99.*********.*******987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.519 | 45 | 96 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.34E-28 | 48 | 142 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.3E-17 | 49 | 98 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.7E-17 | 50 | 95 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.5E-24 | 52 | 105 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.20E-14 | 53 | 96 | No hit | No description |
PROSITE profile | PS51294 | 23.038 | 97 | 142 | IPR017930 | Myb domain |
SMART | SM00717 | 1.0E-7 | 101 | 142 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.3E-16 | 102 | 142 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.47E-11 | 104 | 142 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 7.1E-20 | 106 | 142 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 142 aa Download sequence Send to blast |
MTEVKRENEK GKQVHEATLD LCPPALDIGS KLKLMTVSGR TSGPVRRSTK GGWTDEEDDM 60 LTKAVRQFNG KNWKKIAELF PGRTDLQCRS RWKRVLNPEL IKGTWTKEED DLIIQLVEKH 120 GCKWSVIAKS LPGRIGKQCQ DR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 1e-32 | 50 | 142 | 6 | 142 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 1e-32 | 50 | 142 | 6 | 142 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (PubMed:21862669). Involved in the regulation of cytokinesis, probably via the activation of several G2/M phase-specific genes transcription (e.g. KNOLLE) (PubMed:17287251, PubMed:21862669, PubMed:25806785). Required for the maintenance of diploidy (PubMed:21862669). {ECO:0000269|PubMed:17287251, ECO:0000269|PubMed:21862669, ECO:0000269|PubMed:25806785}.; FUNCTION: Involved in transcription regulation during induced endoreduplication at the powdery mildew (e.g. G.orontii) infection site, thus promoting G.orontii growth and reproduction. {ECO:0000269|PubMed:20018666}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by salicylic acid (SA) (PubMed:16463103). Expressed in a cell cycle-dependent manner, with highest levels 2 hours before the peak of mitotic index in cells synchronized by aphidicolin. Activated by CYCB1 (PubMed:17287251). Accumulates at powdery mildew (e.g. G.orontii) infected cells. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17287251}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008808105.1 | 4e-99 | transcription factor MYB3R-5-like | ||||
Swissprot | Q94FL9 | 3e-45 | MB3R4_ARATH; Transcription factor MYB3R-4 | ||||
TrEMBL | A0A2H3Z4V2 | 1e-97 | A0A2H3Z4V2_PHODC; transcription factor MYB3R-5-like | ||||
STRING | XP_008808105.1 | 2e-98 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP29448 | 2 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G11510.2 | 5e-48 | myb domain protein 3r-4 |
Publications ? help Back to Top | |||
---|---|---|---|
|