PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PDK_30s1198251g001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 199aa MW: 22207.1 Da PI: 5.0071 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 115.8 | 4.4e-36 | 4 | 121 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 lppGf+F P+deelvv++L +k++ +++ ++i+++++ +v+PwdL+ k+ ++ ++wyfFs+r + nr+ +gyW g d++ PDK_30s1198251g001 4 LPPGFQFVPSDEELVVHFLYPKASLLPCHP-DIIPSLNLRHVDPWDLDGKALQGGNQWYFFSQRIQ--------NRVSPNGYWTPIGVDEP 85 79*************************999.99**************977778899******9855........8999************* PP NAM 92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 v s ++++vg+kktLvfy g+ap g+kt+W+m ey+l PDK_30s1198251g001 86 VAS-SDKVVGMKKTLVFYVGEAPCGVKTNWMMIEYHL 121 ***.8999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.23E-47 | 3 | 161 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 42.426 | 4 | 163 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.7E-21 | 5 | 121 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0043067 | Biological Process | regulation of programmed cell death | ||||
GO:0048367 | Biological Process | shoot system development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 199 aa Download sequence Send to blast |
MGGLPPGFQF VPSDEELVVH FLYPKASLLP CHPDIIPSLN LRHVDPWDLD GKALQGGNQW 60 YFFSQRIQNR VSPNGYWTPI GVDEPVASSD KVVGMKKTLV FYVGEAPCGV KTNWMMIEYH 120 LLDGSTNCSS SGSRTHSNRR SSKKRAHQRV VSDNWIICRV YEASCDSVAS SLSDDTELSC 180 LDEVFLSLDD LDEISLPNL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 9e-37 | 4 | 167 | 17 | 169 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 9e-37 | 4 | 167 | 17 | 169 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 9e-37 | 4 | 167 | 17 | 169 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 9e-37 | 4 | 167 | 17 | 169 | NO APICAL MERISTEM PROTEIN |
3swm_A | 9e-37 | 4 | 167 | 20 | 172 | NAC domain-containing protein 19 |
3swm_B | 9e-37 | 4 | 167 | 20 | 172 | NAC domain-containing protein 19 |
3swm_C | 9e-37 | 4 | 167 | 20 | 172 | NAC domain-containing protein 19 |
3swm_D | 9e-37 | 4 | 167 | 20 | 172 | NAC domain-containing protein 19 |
3swp_A | 9e-37 | 4 | 167 | 20 | 172 | NAC domain-containing protein 19 |
3swp_B | 9e-37 | 4 | 167 | 20 | 172 | NAC domain-containing protein 19 |
3swp_C | 9e-37 | 4 | 167 | 20 | 172 | NAC domain-containing protein 19 |
3swp_D | 9e-37 | 4 | 167 | 20 | 172 | NAC domain-containing protein 19 |
4dul_A | 9e-37 | 4 | 167 | 17 | 169 | NAC domain-containing protein 19 |
4dul_B | 9e-37 | 4 | 167 | 17 | 169 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010911499.1 | 1e-118 | NAC domain-containing protein 104 | ||||
Swissprot | Q8GWK6 | 4e-67 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A0A9FYS5 | 6e-83 | A0A0A9FYS5_ARUDO; Uncharacterized protein | ||||
STRING | MLOC_15681.2 | 2e-81 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3667 | 36 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 2e-69 | xylem NAC domain 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|