PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr034417.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 231aa MW: 25986.4 Da PI: 9.0576 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 156.3 | 1.3e-48 | 14 | 138 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 lppGfrF+Ptdeelv +yL+ kv + +l++ ++i+e++++ ++PwdLp ++e+e yfFs++++ky++g+r+nr+t sgyWkatg dk+++s+ ++ Pbr034417.1 14 LPPGFRFQPTDEELVFQYLRCKVFSCPLPA-SIIPEINVCMYDPWDLP---GNSEQERYFFSNKESKYRNGNRANRVTGSGYWKATGADKKIVSSrRN 107 79****************************.89***************...446889***********************************998677 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 + vg kktLvfy+g++p+ +ktdWvmhey l Pbr034417.1 108 HIVGKKKTLVFYRGKSPHVSKTDWVMHEYCL 138 78***************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.01E-57 | 8 | 168 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 54.129 | 14 | 168 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.6E-25 | 15 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 231 aa Download sequence Send to blast |
MDKFKFVGNG MIRLPPGFRF QPTDEELVFQ YLRCKVFSCP LPASIIPEIN VCMYDPWDLP 60 GNSEQERYFF SNKESKYRNG NRANRVTGSG YWKATGADKK IVSSRRNHIV GKKKTLVFYR 120 GKSPHVSKTD WVMHEYCLVN TETTASIHTT ENALTPKGNW VLCRVFSKKR SGKIDEEIVV 180 NYNSIEVNNN ANPASSSSSC SSSTGITEVT SPSKECGEEI SSCRKFDHVN * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-45 | 12 | 173 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-45 | 12 | 173 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-45 | 12 | 173 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-45 | 12 | 173 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-45 | 12 | 173 | 18 | 173 | NAC domain-containing protein 19 |
3swm_B | 1e-45 | 12 | 173 | 18 | 173 | NAC domain-containing protein 19 |
3swm_C | 1e-45 | 12 | 173 | 18 | 173 | NAC domain-containing protein 19 |
3swm_D | 1e-45 | 12 | 173 | 18 | 173 | NAC domain-containing protein 19 |
3swp_A | 1e-45 | 12 | 173 | 18 | 173 | NAC domain-containing protein 19 |
3swp_B | 1e-45 | 12 | 173 | 18 | 173 | NAC domain-containing protein 19 |
3swp_C | 1e-45 | 12 | 173 | 18 | 173 | NAC domain-containing protein 19 |
3swp_D | 1e-45 | 12 | 173 | 18 | 173 | NAC domain-containing protein 19 |
4dul_A | 1e-45 | 12 | 173 | 15 | 170 | NAC domain-containing protein 19 |
4dul_B | 1e-45 | 12 | 173 | 15 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr034417.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009342208.1 | 1e-172 | PREDICTED: NAC domain-containing protein 83-like | ||||
Refseq | XP_009342214.1 | 1e-172 | PREDICTED: NAC domain-containing protein 83-like | ||||
Swissprot | Q9FY93 | 2e-79 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A498JQ41 | 1e-148 | A0A498JQ41_MALDO; Uncharacterized protein | ||||
STRING | XP_009342208.1 | 1e-172 | (Pyrus x bretschneideri) | ||||
STRING | XP_009342214.1 | 1e-172 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF704 | 34 | 139 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 3e-81 | NAC domain containing protein 83 |
Publications ? help Back to Top | |||
---|---|---|---|
|