PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr001551.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 138aa MW: 15526.7 Da PI: 10.1757 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 92.6 | 1.8e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krie+ rqvtfskRrng++KKA+ELSvLCdaeva+++fs +gklye+ss Pbr001551.1 9 KRIEDAASRQVTFSKRRNGLMKKAFELSVLCDAEVALVVFSARGKLYEFSS 59 79***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 5.0E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.062 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.88E-43 | 3 | 70 | No hit | No description |
PRINTS | PR00404 | 3.1E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 7.98E-32 | 3 | 73 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.3E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.1E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.1E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 138 aa Download sequence Send to blast |
MVRGKTQMKR IEDAASRQVT FSKRRNGLMK KAFELSVLCD AEVALVVFSA RGKLYEFSSS 60 SINNTLDRYQ MRVKDAGHLT TKAFEEDMEC SMQPLRASRT SKHGDDHGVF LPQTPNMDVE 120 TDLFIGPPKR RRSGQNP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that promotes flowering, especially in response to vernalization by short periods of cold, in an FLC-inpedendent manner. {ECO:0000269|PubMed:16778081}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr001551.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Maintained at very low levels by the polycomb-group (PcG) proteins MSI1, CLF, and EMF2 via histone methylation (H3K27me3). Derepressed upon cold treatment (vernalization). {ECO:0000269|PubMed:16778081}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB370212 | 2e-85 | AB370212.1 Malus x domestica MADS16 mRNA for MADS-box transcription factor, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009362848.1 | 3e-57 | PREDICTED: agamous-like MADS-box protein AGL19 | ||||
Swissprot | O82743 | 2e-38 | AGL19_ARATH; Agamous-like MADS-box protein AGL19 | ||||
TrEMBL | B2ZZ10 | 1e-49 | B2ZZ10_MALDO; MADS domain class transcription factor | ||||
STRING | XP_009362848.1 | 1e-56 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G22950.1 | 8e-41 | AGAMOUS-like 19 |
Publications ? help Back to Top | |||
---|---|---|---|
|