PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00305g00129.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family GRAS
Protein Properties Length: 574aa    MW: 62931 Da    PI: 4.8877
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00305g00129.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS445.83e-1361885641374
                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                               lv++L++cAeav++++++la+al+ ++  la ++  +m+++a+yf+eALa+r+++        + p+++ e++ +++l++   f+
  Peaxi162Scf00305g00129.1 188 LVHTLMACAEAVQQENFNLADALVRHIGILAVSQSGAMRKVATYFAEALARRIYK--------IYPQDQIESSYTDVLQM--HFY 262
                               689***************************************************9........44555554455555444..4** PP

                      GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAe 170
                               e++P+lkf+h+taNqaIlea++++++vH+iDf+++qG+QWpaL+qaLa R+ gpp +R+Tg+g+p+++++++l+++g++La++Ae
  Peaxi162Scf00305g00129.1 263 ETCPYLKFAHFTANQAILEAFNNCNKVHVIDFSLKQGMQWPALMQALALRACGPPAFRLTGIGPPQPDNSDALQQVGWKLAQLAE 347
                               ************************************************************************************* PP

                      GRAS 171 elgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFle 255
                               ++gv+fef+ +va++l+dl+   L++++ Ea+aVn+v++lhrll++++ le+    v++ +k ++Pk+v++veqea+hn+e F++
  Peaxi162Scf00305g00129.1 348 TIGVEFEFRGFVANSLADLDATILDIRETEAVAVNSVFELHRLLARPGGLEK----VMSSIKLMKPKIVTIVEQEANHNAEMFMD 428
                               ****************************************************....***************************** PP

                      GRAS 256 rflealeyysalfdsleak..................lpreseerikvErellgreivnvvacegaerrerhetlekWrerleea 322
                               rf eal+yys++fdsle++                  +   ++++ ++++++lgr+i+nvvaceg +r+erhetl++Wr r+++a
  Peaxi162Scf00305g00129.1 429 RFNEALHYYSTMFDSLESSssssptttsssstgqqpiV--VNNQDLVMSEVYLGRQICNVVACEGVDRVERHETLSQWRVRMNSA 511
                               ****************9888999999999887765431..35999**************************************** PP

                      GRAS 323 GFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               GF pv+l+++a+kqa++ll+ ++ ++gyrvee++g+l+lgW++rpL+++SaW+
  Peaxi162Scf00305g00129.1 512 GFAPVHLGSNAYKQASMLLALFAgGHGYRVEENDGCLMLGWHTRPLIATSAWQ 564
                               ****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011292.5E-3531104No hitNo description
PfamPF120412.9E-353198IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098566.613162543IPR005202Transcription factor GRAS
PfamPF035141.0E-133188564IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 574 aa     Download sequence    Send to blast
MKRDRDREKS QVLGKSKIWE EEEQQPDAGM DELLAVLGYK VKSSDMAEVA QKLEQLEMAM  60
GTTLEDGINH LSTDTVHKNP SDLSGWVQSM LSELNNTSSI STNFDMAGST TGGVENALNI  120
SSSMNIINDD DLRAIPGGAV FVNNELEDAQ TSHKRLRSSP SSAGSSASFL TDSRPVVLVD  180
SQETGVRLVH TLMACAEAVQ QENFNLADAL VRHIGILAVS QSGAMRKVAT YFAEALARRI  240
YKIYPQDQIE SSYTDVLQMH FYETCPYLKF AHFTANQAIL EAFNNCNKVH VIDFSLKQGM  300
QWPALMQALA LRACGPPAFR LTGIGPPQPD NSDALQQVGW KLAQLAETIG VEFEFRGFVA  360
NSLADLDATI LDIRETEAVA VNSVFELHRL LARPGGLEKV MSSIKLMKPK IVTIVEQEAN  420
HNAEMFMDRF NEALHYYSTM FDSLESSSSS SPTTTSSSST GQQPIVVNNQ DLVMSEVYLG  480
RQICNVVACE GVDRVERHET LSQWRVRMNS AGFAPVHLGS NAYKQASMLL ALFAGGHGYR  540
VEENDGCLML GWHTRPLIAT SAWQLTAAAG GGES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-6318356314378Protein SCARECROW
5b3h_A3e-6318356313377Protein SCARECROW
5b3h_D3e-6318356313377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). Its degradation is not essential for germination. {ECO:0000250, ECO:0000269|PubMed:15347801}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009796771.10.0PREDICTED: DELLA protein GAI-like
SwissprotQ7Y1B60.0GAI_SOLLC; DELLA protein GAI
TrEMBLA0A1U7Y4880.0A0A1U7Y488_NICSY; DELLA protein GAI-like
STRINGXP_009796771.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein
Publications ? help Back to Top
  1. Nir I, et al.
    The Tomato DELLA Protein PROCERA Acts in Guard Cells to Promote Stomatal Closure.
    Plant Cell, 2017. 29(12): p. 3186-3197
    [PMID:29150547]