PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peaxi162Scf00065g00016.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 119aa MW: 13981.7 Da PI: 6.793 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 45.2 | 2.2e-14 | 11 | 56 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++ ++Ed+l+++++++lG++ W++Ia +++ Rt+ ++k++w ++l Peaxi162Scf00065g00016.1 11 RGNFAEDEDDLIIRLHALLGNR-WSLIAGRLP-WRTGDEVKNYWSSHL 56 8999******************.*********.***********8875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 20.446 | 1 | 60 | IPR017930 | Myb domain |
SMART | SM00717 | 4.3E-12 | 10 | 58 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.69E-12 | 11 | 64 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.6E-13 | 11 | 56 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.6E-19 | 12 | 57 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.05E-7 | 13 | 56 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
MNNLKPILEI RGNFAEDEDD LIIRLHALLG NRWSLIAGRL PWRTGDEVKN YWSSHLKQKL 60 RNMGIDPMTY RISDYVCRKS HLDLWHESRE TETNEKPCDA RSSWGQDDHE PSSLPHLKS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. | |||||
UniProt | Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18541146, ECO:0000269|PubMed:9839469}. | |||||
UniProt | INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019238428.1 | 8e-35 | PREDICTED: transcription factor MYB3-like | ||||
Swissprot | P81393 | 1e-25 | MYB08_ANTMA; Myb-related protein 308 | ||||
Swissprot | Q9S9K9 | 1e-25 | MYB3_ARATH; Transcription factor MYB3 | ||||
Swissprot | Q9SZP1 | 2e-25 | MYB4_ARATH; Transcription repressor MYB4 | ||||
TrEMBL | A0A023PKB4 | 3e-34 | A0A023PKB4_PETHY; R2R3-MYB anthocyanin repressor | ||||
STRING | XP_009596675.1 | 1e-33 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G22640.1 | 6e-28 | myb domain protein 3 |