PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peaxi162Scf00038g01316.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 146aa MW: 16102.1 Da PI: 9.6689 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 123.8 | 5.8e-39 | 16 | 76 | 2 | 62 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 ++++lkcprCds ntkfCyynny+lsqPr++Ck+CrryWtkGG+lrn+PvGgg+rk k+s Peaxi162Scf00038g01316.1 16 EQEHLKCPRCDSPNTKFCYYNNYNLSQPRHYCKSCRRYWTKGGTLRNIPVGGGSRKATKRS 76 57899***************************************************98765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 1.0E-28 | 9 | 73 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 4.2E-33 | 18 | 74 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.696 | 20 | 74 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 22 | 58 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MQDQSIYSQI KPQFPEQEHL KCPRCDSPNT KFCYYNNYNL SQPRHYCKSC RRYWTKGGTL 60 RNIPVGGGSR KATKRSASSN NLNNNNNNNK RASTTTTSCS VTTATLPVTS SGPKPEPFGI 120 PPTTIDVSGP FSSSVVADCT LVLVLY |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00199 | DAP | Transfer from AT1G51700 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016562601.1 | 1e-54 | PREDICTED: dof zinc finger protein DOF3.1 | ||||
Swissprot | O82155 | 3e-41 | DOF17_ARATH; Dof zinc finger protein DOF1.7 | ||||
TrEMBL | A0A2G3D0N4 | 9e-54 | A0A2G3D0N4_CAPCH; Dof zinc finger protein DOF3.1 | ||||
STRING | PGSC0003DMT400006421 | 2e-49 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA88 | 24 | 419 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G51700.1 | 6e-40 | DOF zinc finger protein 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|