Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | zf-Dof | 127 | 5.7e-40 | 29 | 89 | 2 | 62 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
++++lkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGGalrn+PvGgg+rk++k+s
AT1G51700.1 29 EQEQLKCPRCDSPNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGALRNIPVGGGTRKSNKRS 89
57899***************************************************99875 PP
|
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Yanagisawa S
The Dof family of plant transcription factors. Trends Plant Sci., 2002. 7(12): p. 555-60 [PMID:12475498] - Park DH, et al.
The Arabidopsis COG1 gene encodes a Dof domain transcription factor and negatively regulates phytochrome signaling. Plant J., 2003. 34(2): p. 161-71 [PMID:12694592] - Lijavetzky D,Carbonero P,Vicente-Carbajosa J
Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families. BMC Evol. Biol., 2003. 3: p. 17 [PMID:12877745] - Vlieghe K, et al.
Microarray analysis of E2Fa-DPa-overexpressing plants uncovers a cross-talking genetic network between DNA replication and nitrogen assimilation. J. Cell. Sci., 2003. 116(Pt 20): p. 4249-59 [PMID:12953064] - Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Ma S,Gong Q,Bohnert HJ
Dissecting salt stress pathways. J. Exp. Bot., 2006. 57(5): p. 1097-107 [PMID:16510518] - Rajagopalan R,Vaucheret H,Trejo J,Bartel DP
A diverse and evolutionarily fluid set of microRNAs in Arabidopsis thaliana. Genes Dev., 2006. 20(24): p. 3407-25 [PMID:17182867] - Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor. Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11 [PMID:17722694] - Hayama R,Agashe B,Luley E,King R,Coupland G
A circadian rhythm set by dusk determines the expression of FT homologs and the short-day photoperiodic flowering response in Pharbitis. Plant Cell, 2007. 19(10): p. 2988-3000 [PMID:17965272] - Soitamo AJ,Piippo M,Allahverdiyeva Y,Battchikova N,Aro EM
Light has a specific role in modulating Arabidopsis gene expression at low temperature. BMC Plant Biol., 2008. 8: p. 13 [PMID:18230142] - Huang D,Wu W,Abrams SR,Cutler AJ
The relationship of drought-related gene expression in Arabidopsis thaliana to hormonal and environmental factors. J. Exp. Bot., 2008. 59(11): p. 2991-3007 [PMID:18552355] - Gaudinier A, et al.
Enhanced Y1H assays for Arabidopsis. Nat. Methods, 2011. 8(12): p. 1053-5 [PMID:22037706] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178]
|