PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00033g00251.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB
Protein Properties Length: 303aa    MW: 33351 Da    PI: 8.6777
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00033g00251.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.15.7e-201257147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                              +g+W++eEdell ++v q+G+++W++I++ ++ gR++k+c++rw + 
  Peaxi162Scf00033g00251.1 12 KGPWSPEEDELLQRLVDQHGPRNWSLISKSVP-GRSGKSCRLRWCNQ 57
                              79******************************.***********985 PP

2Myb_DNA-binding56.65.9e-1866108347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               ++T+eEde +++a++++G++ W+tIar +  gRt++ +k++w++ 
  Peaxi162Scf00033g00251.1  66 AFTPEEDETIIRAHAKFGNK-WATIARLLS-GRTDNAIKNHWNST 108
                               79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.945762IPR017930Myb domain
SuperFamilySSF466897.19E-329105IPR009057Homeodomain-like
SMARTSM007171.8E-171160IPR001005SANT/Myb domain
PfamPF002492.0E-191257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-271365IPR009057Homeodomain-like
CDDcd001672.34E-161456No hitNo description
SMARTSM007173.4E-1563111IPR001005SANT/Myb domain
PROSITE profilePS5129421.9364113IPR017930Myb domain
CDDcd001672.54E-1266109No hitNo description
Gene3DG3DSA:1.10.10.609.4E-2466112IPR009057Homeodomain-like
PfamPF002493.5E-1566108IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MAQRKESLDR IKGPWSPEED ELLQRLVDQH GPRNWSLISK SVPGRSGKSC RLRWCNQLSP  60
QVEHRAFTPE EDETIIRAHA KFGNKWATIA RLLSGRTDNA IKNHWNSTLK RKCCSVSEDL  120
SFETPEQPPL KRSSSVGPGP GPSSPSGSDL SDSGLSCFPQ PPLVYRPVAR PGPIFPPPPP  180
VQIPNPQKPD PKPDPVVQPD PPTSLCLSLP GSENQAVQSP TTAQLPPVAP LPAQQGYEYG  240
GATSATEKQF FTPEFLGVLQ EMIRKEVRNY MSAGFVEKNG MCMMQTDAIR NAVVKRMGIS  300
KIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-39111133105MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-39111133105C-Myb DNA-Binding Domain
1msf_C1e-39111133105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009795719.11e-133PREDICTED: transcription factor MYB44-like
RefseqXP_016502369.11e-133PREDICTED: transcription factor MYB44-like
SwissprotO231601e-82MYB73_ARATH; Transcription factor MYB73
TrEMBLA0A1S4CN341e-131A0A1S4CN34_TOBAC; transcription factor MYB44-like
TrEMBLA0A1U7Y8Y91e-131A0A1U7Y8Y9_NICSY; transcription factor MYB44-like
STRINGXP_009795719.11e-132(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15862471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-69myb domain protein 73
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]