PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MA_9284799g0010

Organism

Picea abies

Taxonomic ID

3329

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea

Family

M-type_MADS

Protein Properties

Length: 63aa MW: 7194.47 Da PI: 10.8478

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MA_9284799g0010	genome	ConGenIE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	97.9	4e-31	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++ rqvtfskRrng+lKKA+ELSvLCdaev +i+fs++gklye+ MA_9284799g0010 9 KRIENTTSRQVTFSKRRNGLLKKAYELSVLCDAEVGLIVFSPRGKLYEFG 58 79**********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	5.0E-42	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	31.917	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	5.23E-30	3	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.38E-39	3	60	No hit	No description
PRINTS	PR00404	6.3E-32	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	7.5E-29	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.3E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.3E-32	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 63 aa Download sequence Send to blast
MVRGKTQMKR IENTTSRQVT FSKRRNGLLK KAYELSVLCD AEVGLIVFSP RGKLYEFGSP 60 RCV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3mu6_A	4e-18	3	60	2	59	Myocyte-specific enhancer factor 2A
3mu6_B	4e-18	3	60	2	59	Myocyte-specific enhancer factor 2A
3mu6_C	4e-18	3	60	2	59	Myocyte-specific enhancer factor 2A
3mu6_D	4e-18	3	60	2	59	Myocyte-specific enhancer factor 2A
6byy_A	7e-18	1	59	1	59	MEF2 CHIMERA
6byy_B	7e-18	1	59	1	59	MEF2 CHIMERA
6byy_C	7e-18	1	59	1	59	MEF2 CHIMERA
6byy_D	7e-18	1	59	1	59	MEF2 CHIMERA
6bz1_A	7e-18	1	59	1	59	MEF2 CHIMERA
6bz1_B	7e-18	1	59	1	59	MEF2 CHIMERA
6bz1_C	7e-18	1	59	1	59	MEF2 CHIMERA
6bz1_D	7e-18	1	59	1	59	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269\|PubMed:15144377, ECO:0000269\|PubMed:17166135}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT102045	4e-97	BT102045.1 Picea glauca clone GQ0164_P01 mRNA sequence.
GenBank	BT123900	4e-97	BT123900.1 Picea sitchensis clone WS04718_J01 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018681699.1	1e-35	PREDICTED: agamous-like MADS-box protein AGL14
Swissprot	Q9XJ60	4e-33	MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBL	A0A0K0M6Y8	5e-35	A0A0K0M6Y8_PINTB; DAL4
STRING	GSMUA_Achr5P20280_001	6e-35	(Musa acuminata)
STRING	XP_006440498.1	7e-35	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP16	17	761

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45660.1	3e-35	AGAMOUS-like 20

Publications ? help Back to Top
Thomson MJ,Edwards JD,Septiningsih EM,Harrington SE,McCouch SR Substitution mapping of dth1.1, a flowering-time quantitative trait locus (QTL) associated with transgressive variation in rice, reveals multiple sub-QTL. Genetics, 2006. 172(4): p. 2501-14 [PMID:16452146] Park SJ, et al. Rice Indeterminate 1 (OsId1) is necessary for the expression of Ehd1 (Early heading date 1) regardless of photoperiod. Plant J., 2008. 56(6): p. 1018-29 [PMID:18774969] Lee S,Jeong DH,An G A possible working mechanism for rice SVP-group MADS-box proteins as negative regulators of brassinosteroid responses. Plant Signal Behav, 2008. 3(7): p. 471-4 [PMID:19704489] Maas LF,McClung A,McCouch S Dissection of a QTL reveals an adaptive, interacting gene complex associated with transgressive variation for flowering time in rice. Theor. Appl. Genet., 2010. 120(5): p. 895-908 [PMID:19949767] Sun C, et al. The histone methyltransferase SDG724 mediates H3K36me2/3 deposition at MADS50 and RFT1 and promotes flowering in rice. Plant Cell, 2012. 24(8): p. 3235-47 [PMID:22892321] Choi SC, et al. Trithorax group protein Oryza sativa Trithorax1 controls flowering time in rice via interaction with early heading date3. Plant Physiol., 2014. 164(3): p. 1326-37 [PMID:24420930] Núñez-López L,Aguirre-Cruz A,Barrera-Figueroa BE,Peña-Castro JM Improvement of enzymatic saccharification yield in Arabidopsis thaliana by ectopic expression of the rice SUB1A-1 transcription factor. PeerJ, 2015. 3: p. e817 [PMID:25780769] Jin J, et al. MORF-RELATED GENE702, a Reader Protein of Trimethylated Histone H3 Lysine 4 and Histone H3 Lysine 36, Is Involved in Brassinosteroid-Regulated Growth and Flowering Time Control in Rice. Plant Physiol., 2015. 168(4): p. 1275-85 [PMID:25855537] Liu X, et al. Brassinosteroid (BR) biosynthetic gene lhdd10 controls late heading and plant height in rice (Oryza sativa L.). Plant Cell Rep., 2016. 35(2): p. 357-68 [PMID:26518431] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Shibaya T, et al. Hd18, Encoding Histone Acetylase Related to Arabidopsis FLOWERING LOCUS D, is Involved in the Control of Flowering Time in Rice. Plant Cell Physiol., 2016. 57(9): p. 1828-38 [PMID:27318280] Alter P, et al. Flowering Time-Regulated Genes in Maize Include the Transcription Factor ZmMADS1. Plant Physiol., 2016. 172(1): p. 389-404 [PMID:27457125]