PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_15204g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 168aa MW: 19671.6 Da PI: 9.9227 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 184 | 3.5e-57 | 6 | 133 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 lppGfrFhPtdeel+ +yLk+kv++ k+el e+i+evdiyk+ePwdLp k + ++++ewyfFs+rd+ky++g+r+nratk+gyWkatgkd++v s MA_15204g0010 6 LPPGFRFHPTDEELLAYYLKRKVHDWKIEL-EIIREVDIYKCEPWDLPeKsLLPGRDSEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVSS 100 79****************************.99**************95334556889*************************************9 PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128 + + vg+kktLvfy+grap+g++t+Wvmheyrl MA_15204g0010 101 -RMNPVGMKKTLVFYRGRAPHGSRTNWVMHEYRL 133 .999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 7.06E-60 | 3 | 138 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 56.74 | 6 | 152 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.3E-30 | 7 | 133 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MAPMSLPPGF RFHPTDEELL AYYLKRKVHD WKIELEIIRE VDIYKCEPWD LPEKSLLPGR 60 DSEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVSS RMNPVGMKKT LVFYRGRAPH 120 GSRTNWVMHE YRLHEMECEG SASFQVSRIS SPCFSFIVKL SGYANSLP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 8e-56 | 1 | 135 | 12 | 144 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 8e-56 | 1 | 135 | 12 | 144 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 8e-56 | 1 | 135 | 12 | 144 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 8e-56 | 1 | 135 | 12 | 144 | NO APICAL MERISTEM PROTEIN |
3swm_A | 8e-56 | 1 | 135 | 15 | 147 | NAC domain-containing protein 19 |
3swm_B | 8e-56 | 1 | 135 | 15 | 147 | NAC domain-containing protein 19 |
3swm_C | 8e-56 | 1 | 135 | 15 | 147 | NAC domain-containing protein 19 |
3swm_D | 8e-56 | 1 | 135 | 15 | 147 | NAC domain-containing protein 19 |
3swp_A | 8e-56 | 1 | 135 | 15 | 147 | NAC domain-containing protein 19 |
3swp_B | 8e-56 | 1 | 135 | 15 | 147 | NAC domain-containing protein 19 |
3swp_C | 8e-56 | 1 | 135 | 15 | 147 | NAC domain-containing protein 19 |
3swp_D | 8e-56 | 1 | 135 | 15 | 147 | NAC domain-containing protein 19 |
4dul_A | 8e-56 | 1 | 135 | 12 | 144 | NAC domain-containing protein 19 |
4dul_B | 8e-56 | 1 | 135 | 12 | 144 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022868651.1 | 2e-85 | NAC domain-containing protein 86-like | ||||
Swissprot | A4VCM0 | 1e-80 | NAC45_ARATH; NAC domain-containing protein 45 | ||||
TrEMBL | A0A3G9D7U9 | 7e-84 | A0A3G9D7U9_9LAMI; NAC domain protein NAC45 (Fragment) | ||||
TrEMBL | A0A3Q0IGZ0 | 4e-83 | A0A3Q0IGZ0_PHODC; NAC domain-containing protein 45-like | ||||
STRING | XP_004490776.1 | 1e-82 | (Cicer arietinum) | ||||
STRING | Solyc02g036430.1.1 | 6e-83 | (Solanum lycopersicum) | ||||
STRING | XP_009765145.1 | 4e-83 | (Nicotiana sylvestris) | ||||
STRING | PGSC0003DMT400055322 | 4e-83 | (Solanum tuberosum) | ||||
STRING | XP_008813657.1 | 6e-84 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP17 | 15 | 800 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G03200.1 | 5e-83 | NAC domain containing protein 45 |
Publications ? help Back to Top | |||
---|---|---|---|
|