PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MA_10435988g0010

Organism

Picea abies

Taxonomic ID

3329

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea

Family

MYB_related

Protein Properties

Length: 106aa MW: 12263 Da PI: 11.404

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MA_10435988g0010	genome	ConGenIE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	49.1	1.3e-15	13	57	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + +++G+g+W++I+r + Rt+ q+ s+ qky MA_10435988g0010 13 PWTEEEHRLFLMGLAKHGKGDWRSISRNFVVSRTPTQVASHAQKY 57 7*******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	19.229	5	62	IPR017930	Myb domain
SuperFamily	SSF46689	1.1E-17	8	62	IPR009057	Homeodomain-like
SMART	SM00717	1.4E-11	10	60	IPR001005	SANT/Myb domain
TIGRFAMs	TIGR01557	2.7E-17	10	60	IPR006447	Myb domain, plants
Gene3D	G3DSA:1.10.10.60	4.4E-13	11	57	IPR009057	Homeodomain-like
Pfam	PF00249	3.1E-13	13	57	IPR001005	SANT/Myb domain
CDD	cd00167	1.70E-10	13	58	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 106 aa Download sequence Send to blast
MECTKQERRK GIPWTEEEHR LFLMGLAKHG KGDWRSISRN FVVSRTPTQV ASHAQKYFLR 60 LSSGNKXXXX AQKYFLRLSS GNKEKERSNI RDIISPNPGA VSRSRL

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepresses strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Functions with GAMYB to integrate diverse nutrient starvation and gibberellin (GA) signaling pathways during germination of grains. Sugar, nitrogen and phosphate starvation signals converge and interconnect with GA to promote the co-nuclear import of MYBS1 and GAMYB, resulting in the expression of a large set of GA-inducible hydrolases, transporters, and regulators that are essential for mobilization of nutrient reserves in the endosperm to support seedling growth (PubMed:22773748). {ECO:0000269\|PubMed:12172034, ECO:0000269\|PubMed:22773748}.
UniProt	Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepress strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. {ECO:0000250\|UniProtKB:Q8LH59}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by sucrose and gibberellic acid (GA). {ECO:0000269\|PubMed:12172034}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT113302	5e-98	BT113302.1 Picea glauca clone GQ03404_E15 mRNA sequence.
GenBank	EF081893	5e-98	EF081893.1 Picea sitchensis clone WS0277_M02 unknown mRNA.
GenBank	EF084448	5e-98	EF084448.1 Picea sitchensis clone WS02910_I01 unknown mRNA.
GenBank	EF678099	5e-98	EF678099.1 Picea sitchensis clone WS02822_H23 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003062320.1	2e-35	predicted protein
Swissprot	B8A9B2	2e-33	MYBS1_ORYSI; Transcription factor MYBS1
Swissprot	Q8LH59	2e-33	MYBS1_ORYSJ; Transcription factor MYBS1
TrEMBL	A9NKW2	5e-51	A9NKW2_PICSI; Uncharacterized protein
TrEMBL	A9NT05	5e-51	A9NT05_PICSI; Uncharacterized protein
STRING	XP_003062320.1	8e-35	(Micromonas pusilla)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP394	16	99

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G49010.1	3e-35	MYB family protein

Publications ? help Back to Top
Hong YF, et al. Convergent starvation signals and hormone crosstalk in regulating nutrient mobilization upon germination in cereals. Plant Cell, 2012. 24(7): p. 2857-73 [PMID:22773748]