PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_101463g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 65aa MW: 7534.91 Da PI: 10.6704 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 90.3 | 1e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien+s rqvtf kRrng+lKKA+ELSvLCdae +++fs++gklye++s MA_101463g0010 9 KRIENTSSRQVTFFKRRNGLLKKAYELSVLCDAELGLMVFSPRGKLYEFAS 59 79***********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF55455 | 9.94E-29 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.665 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.7E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.37E-37 | 2 | 60 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.1E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.4E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.1E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.1E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 65 aa Download sequence Send to blast |
MGRGKTQMKR IENTSSRQVT FFKRRNGLLK KAYELSVLCD AELGLMVFSP RGKLYEFASP 60 RYLCL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-18 | 1 | 59 | 1 | 59 | MEF2C |
5f28_B | 1e-18 | 1 | 59 | 1 | 59 | MEF2C |
5f28_C | 1e-18 | 1 | 59 | 1 | 59 | MEF2C |
5f28_D | 1e-18 | 1 | 59 | 1 | 59 | MEF2C |
6byy_A | 1e-18 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6byy_B | 1e-18 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6byy_C | 1e-18 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6byy_D | 1e-18 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_A | 1e-18 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_B | 1e-18 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_C | 1e-18 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_D | 1e-18 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269|PubMed:15144377, ECO:0000269|PubMed:17166135}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT122987 | 9e-83 | BT122987.1 Picea sitchensis clone WS0464_E15 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007134936.1 | 7e-32 | hypothetical protein PHAVU_010G088100g | ||||
Refseq | XP_007134937.1 | 7e-32 | hypothetical protein PHAVU_010G088100g | ||||
Swissprot | Q9XJ60 | 5e-30 | MAD50_ORYSJ; MADS-box transcription factor 50 | ||||
TrEMBL | A9NKI1 | 4e-31 | A9NKI1_PICSI; Uncharacterized protein | ||||
STRING | XP_007134936.1 | 3e-31 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45660.1 | 5e-32 | AGAMOUS-like 20 |