PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Oropetium_20150105_07634A | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 208aa MW: 22719.7 Da PI: 8.1367 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 61.4 | 1.7e-19 | 1 | 45 | 13 | 58 |
E--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 13 KevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 K+ k++e prsYY+Ct+ gCpvkk vers d+ ++eitY+ +Hnh Oropetium_20150105_07634A 1 KQLKDAESPRSYYKCTHDGCPVKKVVERSF-DGFITEITYKARHNH 45 899***************************.*************** PP | |||||||
2 | WRKY | 105.2 | 3.5e-33 | 100 | 158 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vkg++ prsYY+Ct +C+v+k++er+++dp++v +tY+g+Hnh+ Oropetium_20150105_07634A 100 LDDGYRWRKYGQKVVKGNPRPRSYYKCTADNCNVRKQIERASTDPRCVLTTYTGRHNHD 158 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF118290 | 1.7E-13 | 1 | 48 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 4.0E-15 | 1 | 47 | IPR003657 | WRKY domain |
SMART | SM00774 | 8.9E-14 | 1 | 47 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.0E-13 | 1 | 45 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 15.342 | 1 | 48 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 2.7E-32 | 93 | 160 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 35.06 | 95 | 160 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.48E-28 | 95 | 160 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.5E-35 | 100 | 159 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.1E-24 | 101 | 158 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 208 aa Download sequence Send to blast |
KQLKDAESPR SYYKCTHDGC PVKKVVERSF DGFITEITYK ARHNHLRPPQ RGNDGGDVPA 60 AGIFVEEAVD GXXXXXXXXX XMLHDDHDGD VGRAVDVDLL DDGYRWRKYG QKVVKGNPRP 120 RSYYKCTADN CNVRKQIERA STDPRCVLTT YTGRHNHDPP GRGPEAAAAT TAGSATDHSG 180 PSAMNVAAGA SGTFRQTCGS RPLKEES* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-32 | 96 | 160 | 13 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 3e-32 | 96 | 160 | 13 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Oropetium_20150105_07634A |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK363803 | 2e-64 | AK363803.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2019A07. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025792201.1 | 4e-80 | probable WRKY transcription factor 58 | ||||
Swissprot | Q93WU7 | 2e-48 | WRK58_ARATH; Probable WRKY transcription factor 58 | ||||
TrEMBL | A0A2T8I0M7 | 3e-78 | A0A2T8I0M7_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A3L6TT60 | 2e-78 | A0A3L6TT60_PANMI; Putative WRKY transcription factor 26 | ||||
STRING | Sb01g007480.1 | 6e-76 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2875 | 32 | 36 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G01080.1 | 5e-50 | WRKY DNA-binding protein 58 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Oropetium_20150105_07634A |
Publications ? help Back to Top | |||
---|---|---|---|
|