PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_00632A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 189aa    MW: 20210 Da    PI: 8.5008
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_00632AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.41.6e-13549348
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +W++eEd  l   v+++G ++W++I++ ++  R +k+c++rw ++l
  Oropetium_20150105_00632A  5 AWSKEEDVVLRAQVRLHGARDWEAISAALP-YRNAKSCRLRWCQHL 49
                               8*****************************.***********9986 PP

2Myb_DNA-binding39.61.2e-125899346
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                               ++T+ Ed  +v + + ++++ W+ Ia +++ gRt++ +k+rw+ 
  Oropetium_20150105_00632A 58 PFTPTEDAAIVSLQQAYPNK-WSIIAGHIP-GRTDNAIKNRWNA 99
                               79******************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.766153IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-17252IPR009057Homeodomain-like
SuperFamilySSF466891.45E-27297IPR009057Homeodomain-like
SMARTSM007176.9E-14251IPR001005SANT/Myb domain
PfamPF002492.8E-12449IPR001005SANT/Myb domain
CDDcd001671.13E-13549No hitNo description
SMARTSM007177.1E-1155103IPR001005SANT/Myb domain
PROSITE profilePS5129416.25357105IPR017930Myb domain
CDDcd001677.19E-1058101No hitNo description
PfamPF002495.8E-115899IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-1858102IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MKKAAWSKEE DVVLRAQVRL HGARDWEAIS AALPYRNAKS CRLRWCQHLS PDVDDIRPFT  60
PTEDAAIVSL QQAYPNKWSI IAGHIPGRTD NAIKNRWNAV LRKKPPPPQN RVLTLLPLVS  120
GDIWAARRVA VPVIGHTPTV EGDGAGGGDQ GASCLNLFPL APGDVVGGDA SGAAPMDVDS  180
GADKQLTQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3osf_A3e-22211310119MYB21
3osf_D3e-22211310119MYB21
3osg_A3e-22211310119MYB21
3osg_D3e-22211310119MYB21
3zqc_A2e-2231172115MYB3
3zqc_D2e-2231172115MYB3
3zqc_G2e-2231172115MYB3
3zqc_J2e-2231172115MYB3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_00632A
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025798530.13e-65myb-related protein 308-like
SwissprotQ9SN123e-32MYB77_ARATH; Transcription factor MYB77
TrEMBLA0A2T7CFJ22e-64A0A2T7CFJ2_9POAL; Uncharacterized protein
STRINGPavir.Hb01126.1.p1e-65(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.12e-34myb domain protein 77
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]