PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g34960.1
Common NameLOC107275352, OJ1005_H01.28, Os08g0450900, OSNPB_080450900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 201aa    MW: 21605.3 Da    PI: 6.5138
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g34960.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.1e-151460148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      + +WT+eEde l +av+++   +W+ Ia  ++ +R +k+c++rw ++l
  LOC_Os08g34960.1 14 KTPWTQEEDEALRRAVREHRRQNWAEIALALP-RRGPKSCRLRWCQHL 60
                      579*****************************.***********9986 PP

2Myb_DNA-binding42.71.3e-1368109346
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        +T+eEd +++   + +G++ W+tIar+++ gR ++ +k+rw++
  LOC_Os08g34960.1  68 VFTAEEDAIILAQQRVHGNK-WATIARCLP-GRYDNAVKNRWNS 109
                       59******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.271964IPR017930Myb domain
SMARTSM007172.4E-151362IPR001005SANT/Myb domain
SuperFamilySSF466892.04E-2713107IPR009057Homeodomain-like
PfamPF002491.1E-141460IPR001005SANT/Myb domain
CDDcd001672.39E-131660No hitNo description
Gene3DG3DSA:1.10.10.601.2E-211667IPR009057Homeodomain-like
SMARTSM007173.2E-1065113IPR001005SANT/Myb domain
PROSITE profilePS5129415.71767115IPR017930Myb domain
PfamPF002493.2E-1068109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-1968113IPR009057Homeodomain-like
CDDcd001678.62E-869108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MAADGGDGSG GGRKTPWTQE EDEALRRAVR EHRRQNWAEI ALALPRRGPK SCRLRWCQHL  60
SPELDSRVFT AEEDAIILAQ QRVHGNKWAT IARCLPGRYD NAVKNRWNSA LRKLLQVQHA  120
SGAGSPPAAA AAAAGDDRDD APVCLQLFPA RAGGVKEAGL FAGEKDVEEE DVATSLTLGL  180
PVLCEAELEL RLGPAWPATA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A7e-27141182106MYB3
3zqc_D7e-27141182106MYB3
3zqc_G7e-27141182106MYB3
3zqc_J7e-27141182106MYB3
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6ZLF1
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in leaves from the third leaf to rosette leaves from six-week old plants. Expression follows a development-dependent gradient in successive leaves. {ECO:0000269|PubMed:9678577}.
UniprotTISSUE SPECIFICITY: Expressed in roots, stems and flowers. Expressed in dry seeds (PubMed:9678577). Expressed in root vasculature, root tips and lateral root (PubMed:17675404). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:9678577}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g34960.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g34960
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0037980.0AP003798.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OJ1005_H01.
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649306.11e-142transcription factor MYB77
SwissprotQ9SN124e-34MYB77_ARATH; Transcription factor MYB77
TrEMBLQ6ZLF11e-141Q6ZLF1_ORYSJ; Os08g0450900 protein
STRINGOS08T0450900-001e-142(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.12e-36myb domain protein 77
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]