![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os08g34960.1 | ||||||||
Common Name | LOC107275352, OJ1005_H01.28, Os08g0450900, OSNPB_080450900 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 201aa MW: 21605.3 Da PI: 6.5138 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48.4 | 2.1e-15 | 14 | 60 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 + +WT+eEde l +av+++ +W+ Ia ++ +R +k+c++rw ++l LOC_Os08g34960.1 14 KTPWTQEEDEALRRAVREHRRQNWAEIALALP-RRGPKSCRLRWCQHL 60 579*****************************.***********9986 PP | |||||||
2 | Myb_DNA-binding | 42.7 | 1.3e-13 | 68 | 109 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +T+eEd +++ + +G++ W+tIar+++ gR ++ +k+rw++ LOC_Os08g34960.1 68 VFTAEEDAIILAQQRVHGNK-WATIARCLP-GRYDNAVKNRWNS 109 59******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 22.271 | 9 | 64 | IPR017930 | Myb domain |
SMART | SM00717 | 2.4E-15 | 13 | 62 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.04E-27 | 13 | 107 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.1E-14 | 14 | 60 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.39E-13 | 16 | 60 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.2E-21 | 16 | 67 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.2E-10 | 65 | 113 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 15.717 | 67 | 115 | IPR017930 | Myb domain |
Pfam | PF00249 | 3.2E-10 | 68 | 109 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.8E-19 | 68 | 113 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.62E-8 | 69 | 108 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 201 aa Download sequence Send to blast |
MAADGGDGSG GGRKTPWTQE EDEALRRAVR EHRRQNWAEI ALALPRRGPK SCRLRWCQHL 60 SPELDSRVFT AEEDAIILAQ QRVHGNKWAT IARCLPGRYD NAVKNRWNSA LRKLLQVQHA 120 SGAGSPPAAA AAAAGDDRDD APVCLQLFPA RAGGVKEAGL FAGEKDVEEE DVATSLTLGL 180 PVLCEAELEL RLGPAWPATA * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3zqc_A | 7e-27 | 14 | 118 | 2 | 106 | MYB3 |
3zqc_D | 7e-27 | 14 | 118 | 2 | 106 | MYB3 |
3zqc_G | 7e-27 | 14 | 118 | 2 | 106 | MYB3 |
3zqc_J | 7e-27 | 14 | 118 | 2 | 106 | MYB3 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | Q6ZLF1 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in leaves from the third leaf to rosette leaves from six-week old plants. Expression follows a development-dependent gradient in successive leaves. {ECO:0000269|PubMed:9678577}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems and flowers. Expressed in dry seeds (PubMed:9678577). Expressed in root vasculature, root tips and lateral root (PubMed:17675404). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:9678577}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os08g34960.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os08g34960 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP003798 | 0.0 | AP003798.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OJ1005_H01. | |||
GenBank | AP014964 | 0.0 | AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015649306.1 | 1e-142 | transcription factor MYB77 | ||||
Swissprot | Q9SN12 | 4e-34 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | Q6ZLF1 | 1e-141 | Q6ZLF1_ORYSJ; Os08g0450900 protein | ||||
STRING | OS08T0450900-00 | 1e-142 | (Oryza sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4960 | 34 | 65 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50060.1 | 2e-36 | myb domain protein 77 |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os08g34960.1 |
Entrez Gene | 107275352 |
Publications ? help Back to Top | |||
---|---|---|---|
|