PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os08g05510.2 | ||||||||
Common Name | LOC4344664, Os08g0151000, OSNPB_080151000 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 252aa MW: 26823.5 Da PI: 10.5085 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 45.3 | 2e-14 | 107 | 151 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ ++ + ++lG+g+W+ I++ + ++Rt+ q+ s+ qky LOC_Os08g05510.2 107 PWTEEEHRTFLAGLEKLGKGDWRGISKNFVTTRTPTQVASHAQKY 151 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.431 | 100 | 156 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.58E-18 | 101 | 156 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.9E-18 | 103 | 155 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 3.5E-11 | 104 | 154 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.1E-12 | 107 | 151 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.5E-12 | 107 | 150 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.01E-10 | 107 | 152 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001015 | developmental stage | K second mitotic division stage | ||||
PO:0007130 | developmental stage | sporophyte reproductive stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 252 aa Download sequence Send to blast |
MPQDSRPAAM RLFGVTISPP PPPPEPEPEP DPSDPRDPSP RPAREDAMRK CKSMGNLAAA 60 AAASSAAAGG GGAGDAGGSG DGYLSDGGLL LSSGKRRRAQ ERKKAVPWTE EEHRTFLAGL 120 EKLGKGDWRG ISKNFVTTRT PTQVASHAQK YFLRQTNPNK KKRRSSLFDM MATDMSPAPN 180 CPVLPPSMGK LHDMVAMTKQ LQNSSLEGVS SSSTVNLAPQ VARDLPPPIP SFKATNVDSS 240 LSKMNHMNLL R* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 159 | 163 | KKKRR |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.26109 | 1e-177 | callus| flower| leaf| panicle| root| vegetative meristem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 297607974 | 1e-177 | ||||
Expression Atlas | A0A0P0XBW5 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in all tissues, with the highest level in senescent leaves. {ECO:0000269|PubMed:12172034}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os08g05510.2 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os08g05510 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK242017 | 0.0 | AK242017.1 Oryza sativa Japonica Group cDNA, clone: J075110L24, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015648292.1 | 0.0 | transcription factor MYBS3-like isoform X2 | ||||
Swissprot | Q7XC57 | 1e-44 | MYBS3_ORYSJ; Transcription factor MYBS3 | ||||
TrEMBL | A0A0P0XBW5 | 1e-179 | A0A0P0XBW5_ORYSJ; Os08g0151000 protein | ||||
STRING | OS08T0151000-00 | 1e-180 | (Oryza sativa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47390.1 | 6e-38 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os08g05510.2 |
Entrez Gene | 4344664 |
Publications ? help Back to Top | |||
---|---|---|---|
|