PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os05g09020.2 | ||||||||
Common Name | LOC4337998, Os05g0183100, P0683B12.4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 128aa MW: 14169.8 Da PI: 9.8091 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 96.9 | 1.4e-30 | 28 | 86 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K vk+s++pr+YYrC+++gC+vkk+ver++ed ++v++tY g Hnh LOC_Os05g09020.2 28 LDDGFKWRKYGKKAVKNSPNPRNYYRCSTEGCNVKKRVERDREDHRYVITTYDGVHNHA 86 59********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 6.3E-33 | 16 | 88 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 6.02E-28 | 20 | 88 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.422 | 23 | 88 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.5E-34 | 28 | 87 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.1E-23 | 29 | 85 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009038 | anatomy | palea | ||||
PO:0001048 | developmental stage | palea development stage | ||||
PO:0007130 | developmental stage | sporophyte reproductive stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 128 aa Download sequence Send to blast |
MRYESEEKMR ARVNGRIGFR TRSEVEILDD GFKWRKYGKK AVKNSPNPRN YYRCSTEGCN 60 VKKRVERDRE DHRYVITTYD GVHNHASPAA AAAALQYAAA AGDYYSPPLS SAGSPPAAYS 120 AGGSLLF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-27 | 14 | 89 | 3 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 2e-27 | 14 | 89 | 3 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.19621 | 1e-133 | leaf| panicle| root| stem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 116632997 | 1e-133 | ||||
Expression Atlas | Q65WY5 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os05g09020.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os05g09020 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CT832802 | 0.0 | CT832802.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN033C24, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015638018.1 | 4e-90 | probable WRKY transcription factor 50 | ||||
Swissprot | Q8VWQ5 | 5e-39 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A0E0PIC8 | 1e-88 | A0A0E0PIC8_ORYRU; Uncharacterized protein | ||||
TrEMBL | Q65WY5 | 1e-88 | Q65WY5_ORYSJ; Os05g0183100 protein | ||||
TrEMBL | Q6IEL4 | 1e-88 | Q6IEL4_ORYSI; WRKY transcription factor 67 | ||||
STRING | ORUFI05G05890.1 | 2e-89 | (Oryza rufipogon) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 9e-40 | WRKY DNA-binding protein 50 |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os05g09020.2 |
Entrez Gene | 4337998 |
Publications ? help Back to Top | |||
---|---|---|---|
|