PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os02g43170.2 | ||||||||
Common Name | LOC4330144, Os02g0646200, OSNPB_020646200, P0030D07.27, P0519A12.12 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | DBB | ||||||||
Protein Properties | Length: 209aa MW: 21619 Da PI: 5.0423 | ||||||||
Description | DBB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-B_box | 19.4 | 2.1e-06 | 4 | 43 | 5 | 38 |
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38 C+ + + ++ fC ++ lC+ C H+ H+ LOC_Os02g43170.2 4 QCDVCAAEAASVFCCADEAALCDACDHRVHRAnklagkHR 43 7*****************************7677777776 PP | |||||||
2 | zf-B_box | 24.5 | 5.6e-08 | 62 | 94 | 3 | 35 |
zf-B_box 3 erkCpeHeekelqlfCedCqqllCedClleeHk 35 ++ C+ ++ek+ lfC++++ lC++C + H LOC_Os02g43170.2 62 APLCDICQEKRGFLFCKEDRAILCRECDVPVHT 94 689*************************99884 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50119 | 9.741 | 1 | 47 | IPR000315 | B-box-type zinc finger |
SMART | SM00336 | 8.5E-9 | 1 | 47 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 4.48E-5 | 3 | 47 | No hit | No description |
Pfam | PF00643 | 3.0E-5 | 4 | 44 | IPR000315 | B-box-type zinc finger |
PROSITE profile | PS50119 | 9.684 | 60 | 107 | IPR000315 | B-box-type zinc finger |
SMART | SM00336 | 4.1E-11 | 60 | 107 | IPR000315 | B-box-type zinc finger |
Pfam | PF00643 | 1.6E-6 | 62 | 102 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 8.22E-7 | 63 | 95 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009640 | Biological Process | photomorphogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000989 | Molecular Function | transcription factor activity, transcription factor binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0020039 | anatomy | leaf lamina |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 209 aa Download sequence Send to blast |
MKVQCDVCAA EAASVFCCAD EAALCDACDH RVHRANKLAG KHRRFSLLNP SASGRSPTST 60 TAPLCDICQE KRGFLFCKED RAILCRECDV PVHTASELTM RHSRYLLTGV RLSSEPAASP 120 APPSEEENSS SFCCSADDAV PAPAAPATSH GGSSGSSSIS EYLTTLPGWH VEDFLVDDAT 180 AEAAAAAAAT SSGISANGPC QVGATDRP* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.53236 | 0.0 | callus| flower| leaf| stem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | Q6H630 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that acts as positive regulator of seedling photomorphogenesis (PubMed:17965270). Acts downstream of COP1 and play an important role in early and long-term adjustment of the shade avoidance syndrome (SAS) responses in natural environments (PubMed:21070414). {ECO:0000269|PubMed:17965270, ECO:0000269|PubMed:21070414}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os02g43170.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os02g43170 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK071507 | 0.0 | AK071507.1 Oryza sativa Japonica Group cDNA clone:J023090D24, full insert sequence. | |||
GenBank | HQ858819 | 0.0 | HQ858819.1 Oryza sativa Japonica Group isolate UT1236 ORPHANS transcription factor mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015623928.1 | 1e-144 | B-box zinc finger protein 20 | ||||
Swissprot | Q9LQZ7 | 7e-53 | BBX21_ARATH; B-box zinc finger protein 21 | ||||
TrEMBL | Q6H630 | 1e-142 | Q6H630_ORYSJ; ORPHANS transcription factor | ||||
STRING | OS02T0646200-01 | 1e-143 | (Oryza sativa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G75540.1 | 3e-37 | salt tolerance homolog2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os02g43170.2 |
Entrez Gene | 4330144 |