PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | BGIOSGA026407-PA | ||||||||
Common Name | OsI_27367 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 342aa MW: 37040.9 Da PI: 7.6954 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 169.1 | 1.4e-52 | 8 | 135 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 lppGfrFhPtdeel+ +yL+ ++++ ++++ +i++vdiyk++PwdLp+k+ +e+ewyfFs+rd+ky++g r+nra+ sgyWkatg+dk+++ BGIOSGA026407-PA 8 LPPGFRFHPTDEELILHYLRSRATAGQCPV-PIIADVDIYKFDPWDLPSKAVYGESEWYFFSPRDRKYPNGIRPNRAAGSGYWKATGTDKPIH 99 79****************************.88***************77667899************************************* PP NAM 94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ +ge vg+kk Lvfy+gr pkg+kt+W+mheyrl BGIOSGA026407-PA 100 DSaTGESVGVKKALVFYRGRPPKGTKTSWIMHEYRL 135 9988999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.5E-64 | 5 | 173 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 60.521 | 8 | 173 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.8E-27 | 9 | 135 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 342 aa Download sequence Send to blast |
MSSAATSLPP GFRFHPTDEE LILHYLRSRA TAGQCPVPII ADVDIYKFDP WDLPSKAVYG 60 ESEWYFFSPR DRKYPNGIRP NRAAGSGYWK ATGTDKPIHD SATGESVGVK KALVFYRGRP 120 PKGTKTSWIM HEYRLAADPL AAAANTYKPS SSSRFRNVSM RLDDWVLCRI YKKSGQASPM 180 MPPLAADYDH DEPSGVLDDA YSFYAPPMIS TTLIPKLPKI PSISELFDEH ALAQIFDAAA 240 DPPADHHQHA LAVHPSLNQL LGVGDNFLAE CYPSTASTAT VAGGKRKASP AGDYAGGGHT 300 PAKRLNGSCF DVAPQSVVGG LQATPSSVLA GLNHQMLPPQ LF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 9e-72 | 7 | 178 | 16 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 9e-72 | 7 | 178 | 16 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 9e-72 | 7 | 178 | 16 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 9e-72 | 7 | 178 | 16 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 9e-72 | 7 | 178 | 19 | 173 | NAC domain-containing protein 19 |
3swm_B | 9e-72 | 7 | 178 | 19 | 173 | NAC domain-containing protein 19 |
3swm_C | 9e-72 | 7 | 178 | 19 | 173 | NAC domain-containing protein 19 |
3swm_D | 9e-72 | 7 | 178 | 19 | 173 | NAC domain-containing protein 19 |
3swp_A | 9e-72 | 7 | 178 | 19 | 173 | NAC domain-containing protein 19 |
3swp_B | 9e-72 | 7 | 178 | 19 | 173 | NAC domain-containing protein 19 |
3swp_C | 9e-72 | 7 | 178 | 19 | 173 | NAC domain-containing protein 19 |
3swp_D | 9e-72 | 7 | 178 | 19 | 173 | NAC domain-containing protein 19 |
4dul_A | 9e-72 | 7 | 178 | 16 | 170 | NAC domain-containing protein 19 |
4dul_B | 9e-72 | 7 | 178 | 16 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.18595 | 0.0 | callus| flower| leaf| panicle| root| seed| stem| vegetative meristem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 32978623 | 0.0 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed at the base of the inflorescence meristem and at late stages of development in petals and stamens. Up-regulated during leaf senescence. {ECO:0000269|PubMed:16640597, ECO:0000269|PubMed:9489703}. | |||||
Uniprot | DEVELOPMENTAL STAGE: Up-regulated during anther and flower development and leaf senescence. {ECO:0000269|PubMed:22278768}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in senescing leaves, petals and sepals. {ECO:0000269|PubMed:16640597}. | |||||
Uniprot | TISSUE SPECIFICITY: Highest expression in stamens. Expressed in leaves. {ECO:0000269|PubMed:18813954, ECO:0000269|PubMed:22278768}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to, and transactivates the promoter of the abscisic aldehyde oxidase AAO3. Promotes chlorophyll degradation in leaves by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone abscisic acid (ABA) (PubMed:25516602). Involved in the control of dehydration in senescing leaves. Binds to the DNA sequence 5'-CACGTAAGT-3' of SAG113 promoter. SAG113 acts as negative regulator of ABA signaling for stomatal closure in leaves, and controls water loss during leaf senescence (PubMed:22184656). Transcription factor of the NAC family involved in senescence. May function in the transition between active cell division and cell expansion (PubMed:16640597). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:16640597, ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:25516602}. | |||||
UniProt | Transcription factor of the NAC family associated with male fertility. Involved in anther development, but not in senescence. Reduced expression of NAC5 via RNAi leads to male-sterility. {ECO:0000269|PubMed:22278768}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by the heterodimer APETALA3 (AP3)/PISTILLATA (PI) (PubMed:9489703). Induced by senescence (PubMed:22184656, PubMed:24659488, PubMed:25516602). Induced by abscisic acid (ABA) (PubMed:22184656, PubMed:25516602). Induced by ethylene (PubMed:25516602). {ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:24659488, ECO:0000269|PubMed:25516602, ECO:0000269|PubMed:9489703}. | |||||
UniProt | INDUCTION: Up-regulated by drought, salt and cold treatments. {ECO:0000269|PubMed:18813954}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CT829369 | 0.0 | CT829369.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA056N06, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015647490.1 | 0.0 | NAC transcription factor 29 | ||||
Swissprot | O49255 | 7e-82 | NAC29_ARATH; NAC transcription factor 29 | ||||
Swissprot | Q8H4S4 | 2e-81 | NAC10_ORYSJ; NAC domain-containing protein 10 | ||||
TrEMBL | A0A0E0QCV3 | 0.0 | A0A0E0QCV3_ORYRU; Uncharacterized protein | ||||
TrEMBL | B8B641 | 0.0 | B8B641_ORYSI; Uncharacterized protein | ||||
TrEMBL | B9FUX7 | 0.0 | B9FUX7_ORYSJ; Uncharacterized protein | ||||
TrEMBL | I1QDA4 | 0.0 | I1QDA4_ORYGL; Uncharacterized protein | ||||
STRING | ORUFI07G27590.1 | 0.0 | (Oryza rufipogon) | ||||
STRING | ORGLA07G0209600.1 | 0.0 | (Oryza glaberrima) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1237 | 36 | 123 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69490.1 | 7e-83 | NAC-like, activated by AP3/PI |