PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | BGIOSGA011849-PA | ||||||||
Common Name | OsI_09990 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 219aa MW: 23369.2 Da PI: 9.02 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 60 | 3.1e-19 | 124 | 157 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 C++C + +Tp+WR gpdg++tLCnaCG+++++ + BGIOSGA011849-PA 124 CTHCAVDETPQWRLGPDGPRTLCNACGVRFKSGR 157 *******************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 11.517 | 118 | 154 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 1.1E-15 | 118 | 168 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 3.23E-15 | 120 | 182 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 5.3E-14 | 122 | 155 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 6.41E-16 | 124 | 172 | No hit | No description |
Pfam | PF00320 | 1.5E-17 | 124 | 157 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 124 | 149 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 219 aa Download sequence Send to blast |
MVGDKDAAAL AGELTGDAGA SLNGFFDHTG LESAVVGEGQ GEGEEEEELE WLSNKDAFPS 60 VDTMAAEVES AAPGAPARAA VGPRTKGLRR RRRVTAPWSL APLLSRPRQA AAAAADAGAP 120 RRRCTHCAVD ETPQWRLGPD GPRTLCNACG VRFKSGRLFP EYRPANSPTF SPLLHSNSHR 180 RVMEMRLQSE EDASAASRVN AKARRAERAA ARLAGKDKK |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.6408 | 0.0 | callus| flower |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 116012100 | 0.0 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mostly expressed in roots. Also expressed in stems, flowers and leaves. {ECO:0000269|PubMed:12139008}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: In leaves, less expressed in dark than in light. {ECO:0000269|PubMed:12139008}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK242735 | 0.0 | AK242735.1 Oryza sativa Japonica Group cDNA, clone: J090048J08, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015629220.1 | 1e-156 | GATA transcription factor 3 | ||||
Swissprot | Q8L4M6 | 1e-36 | GATA3_ARATH; GATA transcription factor 3 | ||||
TrEMBL | A0A0E0GGQ1 | 1e-155 | A0A0E0GGQ1_ORYNI; Uncharacterized protein | ||||
TrEMBL | A2XCF9 | 1e-155 | A2XCF9_ORYSI; Uncharacterized protein | ||||
TrEMBL | Q8H036 | 1e-155 | Q8H036_ORYSJ; GATA zinc finger family protein | ||||
STRING | OS03T0145200-01 | 1e-156 | (Oryza sativa) | ||||
STRING | ONIVA03G03270.1 | 1e-156 | (Oryza nivara) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1417 | 33 | 108 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54810.2 | 3e-34 | GATA family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|