PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | BGIOSGA011479-PA | ||||||||
Common Name | OsI_09964 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 248aa MW: 28899.6 Da PI: 7.0863 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.2 | 8.1e-18 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+ Ed ll ++v+q+G g+W+++a+ g++R++k+c++rw +yl BGIOSGA011479-PA 15 KGPWTALEDRLLTEYVQQHGEGSWNSVAKLTGLRRSGKSCRLRWVNYL 62 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 53.1 | 7.4e-17 | 68 | 112 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ T++E+ +++++++lG++ W++Iar+++ gRt++++k++w+++ BGIOSGA011479-PA 68 RGKITPDEETVILQLHAMLGNR-WSAIARCLP-GRTDNEIKNYWRTH 112 8999******************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.842 | 10 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.04E-30 | 12 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.8E-15 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.7E-17 | 15 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-23 | 16 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.14E-10 | 17 | 62 | No hit | No description |
PROSITE profile | PS51294 | 23.403 | 63 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 9.9E-16 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.3E-15 | 68 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.7E-24 | 70 | 115 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.38E-10 | 72 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 248 aa Download sequence Send to blast |
MDEIRSLMLQ QGWRKGPWTA LEDRLLTEYV QQHGEGSWNS VAKLTGLRRS GKSCRLRWVN 60 YLRPDLKRGK ITPDEETVIL QLHAMLGNRW SAIARCLPGR TDNEIKNYWR THFKKARPSR 120 RARAQLLHQY QLQQQQQHRQ YLHSLNLLQQ QQQQLQQQQQ QQQQQMMLLQ EQEQQSPQEE 180 AADDSMVMMM MMNDLQSKER CCTAVSVVPD DCVLPADDDA IWDSLWRLVD GDGSCGEGSS 240 GGEYWATS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-27 | 15 | 115 | 27 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 115450664 | 0.0 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Present in a small patch of cells on the innermost side of the hypocotyl hook of the germinating seedling, in the subapical pith cells of plants growing vegetatively, in a similar zone of expanding cells both in developing inflorescence stems, and below mature flowers and elongating siliques (PubMed:11743113). Accumulates in the pollen tube nucleus during pollen tube growth through the pistil (PubMed:23791732). {ECO:0000269|PubMed:11743113, ECO:0000269|PubMed:23791732}. | |||||
Uniprot | TISSUE SPECIFICITY: Present mostly in flowers, siliques and floral shoot tips (PubMed:11743113, PubMed:25268707). Expression is restricted to the subapical pith cells of both vegetative and flowering plants and to the hypocotyl hook (PubMed:11743113). Expressed in pollen grains and pollen tube (PubMed:23791732, PubMed:24278028). Mostly expressed in mature pollen grains, and, to a lower extent, in inflorescences and siliques (PubMed:24278028). {ECO:0000269|PubMed:11743113, ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028, ECO:0000269|PubMed:25268707}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator (PubMed:24278028, PubMed:25268707). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter (e.g. alpha-amylase) to promote their expression (PubMed:11743113). Positive regulator of abscisic acid (ABA) responses leading to growth arrest during seed germination (PubMed:17217461). Promotes the expression of aleurone-related genes (e.g. CP1, CP, GASA1, BXL1 and BXL2) in seeds. Together with MYB33 and MYB65, promotes the programmed cell death (PCD) leading to vacuolation of protein storage vacuoles (PSVs) in the aleurone layers during seed germination (PubMed:20699403). Maybe involved in the regulation of leaves lamina morphogenesis (PubMed:25268707). Involved in pollen grain development (PubMed:22101548). Together with MYB97 and MYB120, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000269|PubMed:11743113, ECO:0000269|PubMed:17217461, ECO:0000269|PubMed:20699403, ECO:0000269|PubMed:22101548, ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028, ECO:0000269|PubMed:25268707}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed in germinating seeds by microRNA159 (miR159)-mediated cleavage in an abscisic acid (ABA) and ABI3-dependent manner, probably to desensitize hormone signaling during seedling stress responses (PubMed:15226253, PubMed:17217461). Induced by increased upon gibberellic acid (GA) treatment (PubMed:20699403). {ECO:0000269|PubMed:15226253, ECO:0000269|PubMed:17217461, ECO:0000269|PubMed:20699403}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP012611 | 0.0 | CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015630196.1 | 1e-124 | transcription factor WER | ||||
Swissprot | O80883 | 2e-48 | MB101_ARATH; Transcription factor MYB101 | ||||
TrEMBL | A2XCD3 | 0.0 | A2XCD3_ORYSI; Uncharacterized protein | ||||
STRING | ORUFI03G03040.1 | 1e-123 | (Oryza rufipogon) | ||||
STRING | OS03T0142600-00 | 1e-123 | (Oryza sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP13228 | 24 | 33 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G24310.1 | 2e-61 | myb domain protein 305 |
Publications ? help Back to Top | |||
---|---|---|---|
|